Active Recombinant Human CADM4, Fc-tagged

• Cat.No.: CADM4-651H
• Product Overview: The recombinant human NECL4-Fc fusion protein is expressed as a 532-amino acid protein consisting of Pro21 - Ala324 region of NECL4 (UniProt accession #Q8NFZ8) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.

Specification

• Source: Human cells
• Species: Human
• Tag: Fc
• Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free).
• Bio-activity: Immobilized NECL4 interact heterophilically with NECL1 and NECL3. Enhances neurite outgrowth of E16-E18 rat embryonic cortical neurons.
• Molecular Mass: Calculated molecular mass (kDa): 59.0; Estimated by SDS-PAGE under reducing condition (kDa): 75-85
• AA Sequence: PGAGQEVQTENVTVAEGGVAEITCRLHQYDGSIVVIQNPARQTLFFNGTRALKDERFQLEEFSPRRVRIRLSDA RLEDEGGYFCQLYTEDTHHQIATLTVLVAPENPVVEVREQAVEGGEVELSCLVPRSRPAATLRWYRDRKELKGV SSSQENGKVWSVASTVRFRVDRKDDGGIIICEAQNQALPSGHSKQTQYVLDVQYSPTARIHASQAVVREGDTLV LTCAVTGNPRPNQIRWNRGNESLPERAEAVGETLTLPGLVSADNGTYTCEASNKHGHARALYVLVVYDPGAVVE AQTSVPYASTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH NAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMT KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALH NHYTQKSLSLSPGK
• Endotoxin: <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">
• Purity: >95% judged by SDS-PAGE under reducing condition
• Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
• Protein length: 21-324 a.a.

Gene Information

• Gene Name: CADM4 cell adhesion molecule 4 [ Homo sapiens ]
• Official Symbol: CADM4
• Synonyms: CADM4; cell adhesion molecule 4; IGSF4C, immunoglobulin superfamily, member 4C; Necl 4; nectin like 4; SynCAM4; TSLL2; TSLC1-like 2; nectin-like 4; TSLC1-like protein 2; nectin-like protein 4; immunoglobulin superfamily member 4C; immunoglobulin superfamily, member 4C; NECL4; IGSF4C; Necl-4; synCAM4
• Gene ID: 199731
• mRNA Refseq: NM_145296
• Protein Refseq: NP_660339
• MIM: 609744
• UniProt ID: Q8NFZ8
• Chromosome Location: 19q13.32