Active Recombinant Human C10orf54, Fc-tagged, Biotinylated

• Cat.No.: C10orf54-544H
• Product Overview: The recombinant human B7-H5-Fc fusion protein is expressed as a 390 amino acid protein consisting of Phe33 - Ala194 region of B7-H5 (UniProt accession #Q9H7M9) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.

Specification

• Source: Human cells
• Species: Human
• Tag: Fc
• Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
• Bio-activity: Inhibits anti-CD3e antibody induced IL-2 secretion in human T cells.
• Molecular Mass: Calculated molecular mass 43.7 kDa; estimated by SDS-PAGE under reducing condition 65-70 kDa probably due to glycosylation
• AA Sequence: FKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQA ANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVV YPSSSQDSENITAASTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYV DGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPP SREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSV MHEALHNHYTQKSLSLSPGK
• Endotoxin: <0.1 eu per 1 μg of purified recombinant protein determined by the
• Purity: >95% judged by SDS-PAGE under reducing condition
• Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
• Protein length: 33-194 a.a.

Gene Information

• Gene Name: C10orf54 chromosome 10 open reading frame 54 [ Homo sapiens ]
• Official Symbol: C10orf54
• Synonyms: C10ORF54; chromosome 10 open reading frame 54; platelet receptor Gi24; B7 H5; GI24; SISP1; stress induced secreted protein 1; B7-H5; PP2135
• Gene ID: 64115
• mRNA Refseq: NM_022153
• Protein Refseq: NP_071436
• UniProt ID: Q9H7M9
• Chromosome Location: 10q22.1
• Function: receptor activity