Active Recombinant Human BDNF Protein
Cat.No. : | BDNF-04H |
Product Overview : | Recombinant Human BDNF Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | Brain-derived neurotrophic factor (BDNF) is a nerve growth factor that binds two receptors, the low-affinity nerve growth factor receptor (LNGFR) and the tropomyosin receptor kinase B (TrkB), to support neuron growth and survival. BDNF expression in the hippocampus is essential for long-term memory storage and learning. Human, mouse, rat, and pig BDNF are cross-reactive. |
Bio-activity : | C6 cell proliferation, ≤2 μg/mL; ≥5.0 x 102 units/mg |
Molecular Mass : | Noncovalent Homodimer, 13.6/27.3 kDa (120/240 aa) |
AA Sequence : | MHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA) |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | BDNF brain-derived neurotrophic factor [ Homo sapiens (human) ] |
Official Symbol | BDNF |
Synonyms | BDNF; brain-derived neurotrophic factor; neurotrophin; abrineurin; MGC34632; |
Gene ID | 627 |
mRNA Refseq | NM_001143805 |
Protein Refseq | NP_001137277 |
MIM | 113505 |
UniProt ID | P23560 |
◆ Recombinant Proteins | ||
BDNF-3252C | Recombinant Chicken BDNF | +Inquiry |
BDNF-22H | Recombinant Human BDNF Protein, His-tagged | +Inquiry |
BDNF-1105H | Recombinant Human BDNF protein, His-Myc-tagged | +Inquiry |
BDNF-72H | Recombinant Human BDNF protein | +Inquiry |
BDNF-01H | Recombinant Active Human BDNF Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BDNF-001MCL | Recombinant Mouse BDNF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BDNF Products
Required fields are marked with *
My Review for All BDNF Products
Required fields are marked with *
0
Inquiry Basket