Active Recombinant Human ARMETL1 protein

Cat.No. : ARMETL1-839H
Product Overview : Human ARMETL1 (Q49AH0) partial recombinant protein expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Description : CDNF (Cerebral Dopamine Neurotrophic Factor) is a Protein Coding gene. GO annotations related to this gene include growth factor activity. An important paralog of this gene is MANF.
Form : Lyophilized
Bio-activity : Determined by its ability to stimulate the proliferation of rat C6 cells. The expected ED50 for this effect is 15-25 ug/mL.
Molecular Mass : 18.5 kDa
AA Sequence : MQEAGGRPGADCEVCKEFLNRFYKSLIDRGVNFSLDTIEKELISFCLDTKGKENRLCYYLGATKDAATKILSEVTRPMSVHMPAMKICEKLKKLDSQICELKYEKTLDLASVDLRKMRVAELKQILHSWGEECRACAEKTDYVNLIQELAPKYAATHPKTEL
Endotoxin : Endotoxin level is < 0.1 ng/ug of protein (< 1 EU/ug).
Purity : 98%
Applications : Functional Study; SDS-PAGE
Usage : Activity assay
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage : Store at -20 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : Lyophilized from solutions contain no sodiun azide nor carrier protein
Gene Name CDNF cerebral dopamine neurotrophic factor [ Homo sapiens ]
Official Symbol CDNF
Synonyms CDNF; cerebral dopamine neurotrophic factor; arginine rich, mutated in early stage tumors like 1 , ARMETL1; conserved dopamine neurotrophic factor; ARMET-like protein 1; arginine-rich, mutated in early stage tumors-like 1; ARMETL1;
Gene ID 441549
mRNA Refseq NM_001029954
Protein Refseq NP_001025125
MIM 611233
UniProt ID Q49AH0

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CDNF Products

Required fields are marked with *

My Review for All CDNF Products

Required fields are marked with *

0

Inquiry Basket

cartIcon