Active Recombinant Human ARMETL1 protein
Cat.No. : | ARMETL1-839H |
Product Overview : | Human ARMETL1 (Q49AH0) partial recombinant protein expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Description : | CDNF (Cerebral Dopamine Neurotrophic Factor) is a Protein Coding gene. GO annotations related to this gene include growth factor activity. An important paralog of this gene is MANF. |
Form : | Lyophilized |
Bio-activity : | Determined by its ability to stimulate the proliferation of rat C6 cells. The expected ED50 for this effect is 15-25 ug/mL. |
Molecular Mass : | 18.5 kDa |
AA Sequence : | MQEAGGRPGADCEVCKEFLNRFYKSLIDRGVNFSLDTIEKELISFCLDTKGKENRLCYYLGATKDAATKILSEVTRPMSVHMPAMKICEKLKKLDSQICELKYEKTLDLASVDLRKMRVAELKQILHSWGEECRACAEKTDYVNLIQELAPKYAATHPKTEL |
Endotoxin : | Endotoxin level is < 0.1 ng/ug of protein (< 1 EU/ug). |
Purity : | 98% |
Applications : | Functional Study; SDS-PAGE |
Usage : | Activity assay SDS-PAGE The optimal working dilution should be determined by the end user. |
Storage : | Store at -20 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | Lyophilized from solutions contain no sodiun azide nor carrier protein |
Gene Name | CDNF cerebral dopamine neurotrophic factor [ Homo sapiens ] |
Official Symbol | CDNF |
Synonyms | CDNF; cerebral dopamine neurotrophic factor; arginine rich, mutated in early stage tumors like 1 , ARMETL1; conserved dopamine neurotrophic factor; ARMET-like protein 1; arginine-rich, mutated in early stage tumors-like 1; ARMETL1; |
Gene ID | 441549 |
mRNA Refseq | NM_001029954 |
Protein Refseq | NP_001025125 |
MIM | 611233 |
UniProt ID | Q49AH0 |
◆ Cell & Tissue Lysates | ||
CDNF-2028MCL | Recombinant Mouse CDNF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CDNF Products
Required fields are marked with *
My Review for All CDNF Products
Required fields are marked with *
0
Inquiry Basket