Active Recombinant Human ACVR1C, Fc-tagged, Biotinylated

• Cat.No.: ACVR1C-530H
• Product Overview: The recombinant human ACVR1C/ALK7-Fc fusion protein is expressed as a 320 amino acid protein consisting of Leu22 - Glu113 region of ACVR1C (UniProt accession #Q8NER5) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.

Specification

• Species: Human
• Source: Human Cells
• Tag: Fc
• Protein Length: 22-113 a.a.
• Form: Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
• Bio-activity: Immobilized ACVR1C binds human Nodal in a functional ELISA. Blocks Nodal-mediated signaling activity.
• Molecular Mass: Calculated molecular mass (kDa): 35.5; Estimated by SDS-PAGE under reducing condition (kDa): 50-55
• AA Sequence: LSPGLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVIKSCVSLPELNAQVFCHSSNNVTKTECCFTDFCNNI TLHLPTASPNAPKLGPMESTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKF NWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQV YTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNV FSCSVMHEALHNHYTQKSLSLSPGK
• Endotoxin: <0.1 eu per 1 μg of purified recombinant protein determined by the
• Purity: >95% judged by SDS-PAGE under reducing condition.
• Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.

Gene Information

• Gene Name: ACVR1C activin A receptor, type IC [ Homo sapiens ]
• Official Symbol: ACVR1C
• Synonyms: ACVR1C; activin A receptor, type IC; activin receptor type-1C; ACVRLK7; ALK7; ALK-7; ACTR-IC; activin receptor type IC; activin receptor-like kinase 7
• Gene ID: 130399
• mRNA Refseq: NM_001111031
• Protein Refseq: NP_001104501
• MIM: 608981
• UniProt ID: Q8NER5
• Chromosome Location: 2q24.2
• Pathway: Developmental Biology, organism-specific biosystem; MAPK signaling pathway, organism-specific biosystem; Regulation of Signaling by NODAL, organism-specific biosystem; Signaling by NODAL, organism-specific biosystem; TGF-beta signaling pathway, organism-specific biosystem; TGF-beta signaling pathway, conserved biosystem
• Function: ATP binding; activin receptor activity, type I; metal ion binding; nucleotide binding; receptor activity; transforming growth factor beta-activated receptor activity