Active Recombinant Human ACVR1C, Fc-tagged, Biotinylated
Cat.No. : | ACVR1C-530H |
Product Overview : | The recombinant human ACVR1C/ALK7-Fc fusion protein is expressed as a 320 amino acid protein consisting of Leu22 - Glu113 region of ACVR1C (UniProt accession #Q8NER5) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Fc |
Protein Length : | 22-113 a.a. |
Form : | Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
Bio-activity : | Immobilized ACVR1C binds human Nodal in a functional ELISA. Blocks Nodal-mediated signaling activity. |
Molecular Mass : | Calculated molecular mass (kDa): 35.5; Estimated by SDS-PAGE under reducing condition (kDa): 50-55 |
AA Sequence : | LSPGLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVIKSCVSLPELNAQVFCHSSNNVTKTECCFTDFCNNI TLHLPTASPNAPKLGPMESTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKF NWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQV YTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNV FSCSVMHEALHNHYTQKSLSLSPGK |
Endotoxin : | <0.1 eu per 1 μg of purified recombinant protein determined by the |
Purity : | >95% judged by SDS-PAGE under reducing condition. |
Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
Gene Name | ACVR1C activin A receptor, type IC [ Homo sapiens ] |
Official Symbol | ACVR1C |
Synonyms | ACVR1C; activin A receptor, type IC; activin receptor type-1C; ACVRLK7; ALK7; ALK-7; ACTR-IC; activin receptor type IC; activin receptor-like kinase 7; |
Gene ID | 130399 |
mRNA Refseq | NM_001111031 |
Protein Refseq | NP_001104501 |
MIM | 608981 |
UniProt ID | Q8NER5 |
Chromosome Location | 2q24.2 |
Pathway | Developmental Biology, organism-specific biosystem; MAPK signaling pathway, organism-specific biosystem; Regulation of Signaling by NODAL, organism-specific biosystem; Signaling by NODAL, organism-specific biosystem; TGF-beta signaling pathway, organism-specific biosystem; TGF-beta signaling pathway, conserved biosystem; |
Function | ATP binding; activin receptor activity, type I; metal ion binding; nucleotide binding; receptor activity; transforming growth factor beta-activated receptor activity; |
◆ Recombinant Proteins | ||
ACVR1C-8816C | Recombinant Cynomolgus ACVR1C, Fc tagged | +Inquiry |
ACVR1C-232R | Recombinant Rhesus monkey ACVR1C Protein, His-tagged | +Inquiry |
ACVR1C-493R | Recombinant Rat ACVR1C Protein | +Inquiry |
Acvr1c-502R | Recombinant Rat Activin A Receptor, Type IC | +Inquiry |
ALK7-3271H | Recombinant Human ALK7, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACVR1C-1277CCL | Recombinant Cynomolgus ACVR1C cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ACVR1C Products
Required fields are marked with *
My Review for All ACVR1C Products
Required fields are marked with *
0
Inquiry Basket