Active Recombinant Full Length Mouse Got2 protein, His tagged

• Cat.No.: Got2-23MFL
• Product Overview: Recombinant mouse GOT2 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• ProteinLength: 1-430aa
• Description: Enables L-aspartate:2-oxoglutarate aminotransferase activity. Acts upstream of or within dicarboxylic acid metabolic process. Located in mitochondrion. Is expressed in several structures, including alimentary system; nervous system; respiratory system; sensory organ; and urinary system. Human ortholog(s) of this gene implicated in developmental and epileptic encephalopathy 82. Orthologous to human GOT2 (glutamic-oxaloacetic transaminase 2).
• Tag: N-His
• Form: Liquid
• Bio-activity: Specific activity is > 20 unit/mg, and is defined as the amount of enzyme that converts 1umole of alpha-ketoglutarate to L-Glutamate per minute at pH 8.0 at 25 centigrade.
• Molecular Mass: 46.8 kDa (422aa) confirmed by MALDI-TOF
• AA Sequence: SSWWTHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENNEVLKSGRFVTVQTISGTGALRVGASFLQRFFKFSRDVFLPKPSWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFSGALEDISKIPEQSVLLLHACAHNPTGVDPRPEQWKEIASVVKKKNLFAFFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTVVCKDAEEAKRVESQLKILIRPLYSNPPLNGARIAATILTSPDLRKQWLQEVKGMADRIISMRTQLVSNLKKEGSSHNWQHITDQIGMFCFTGLKPEQVERLTKEFSVYMTKDGRISVAGVTSGNVGYLAHAIHQVTK
• Endotoxin: < 1 EU/μg of protein (determined by LAL method)
• Purity: > 90% by SDS-PAGE
• Applications: SDS-PAGE, Enzyme Activity
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Storage Buffer: Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
• Concentration: 0.5 mg/mL (determined by Bradford assay)
• References: 1. Honorat JA., et al. (2017) PLoS One. 12(11):e0187215.
  2. Han Q., et al. (2010) BMC Biochemistry. 11:19.

Gene Information

• Gene Name: Got2 glutamatic-oxaloacetic transaminase 2, mitochondrial [ Mus musculus (house mouse) ]
• Official Symbol: Got2
• Synonyms: GOT2; glutamate oxaloacetate transaminase 2, mitochondrial; aspartate aminotransferase, mitochondrial; FABP-1; FABPpm; transaminase A; fatty acid-binding protein; mitochondrial aspartate aminotransferase; plasma membrane fatty acid binding protein; plasma membrane-associated fatty acid-binding protein; Got-2; mAspAT; FABP-pm; AL022787; MGC102129; MGC115763
• Gene ID: 14719
• mRNA Refseq: NM_010325
• Protein Refseq: NP_034455
• UniProt ID: O09188