Active Recombinant Full Length Human UBE2L3 Protein, GST tagged

• Cat.No.: UBE2L3-30HFL
• Product Overview: Human UBE2L3 full-length ORF ( AAH53368, 1 a.a. - 154 a.a.) recombinant protein with GST-tag at N-terminal was expressed in E. coli.

Specification

• Description: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s) and ubiquitin-protein ligases (E3s). This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is demonstrated to participate in the ubiquitination of p53, c-Fos, and the NF-kB precursor p105 in vitro. Several alternatively spliced transcript variants have been found for this gene.
• Source: E. coli
• Species: Human
• Tag: N-GST
• Protein length: 1-154aa
• Molecular Mass: ~45 kDa
• AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSMAASRRLMKELEEIRKCGMKNFRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRPVD
• Purity: >85% by SDS-PAGE
• Stability: 12 months at -70 centigrade; aliquot as required
• Storage: Store at -70 centigrade.
• Storage Buffer: 50 mM HEPES pH 7.5, 150 mM sodium chloride, 2 mM dithiothreitol, 10% glycerol
• Concentration: 1 mg/mL

Gene Information

• Gene Name: UBE2L3 ubiquitin conjugating enzyme E2 L3 [ Homo sapiens (human) ]
• Official Symbol: UBE2L3
• Synonyms: UBE2L3; ubiquitin conjugating enzyme E2 L3; E2-F1; L-UBC; UBCH7; UbcM4; ubiquitin-conjugating enzyme E2 L3; E2 ubiquitin-conjugating enzyme L3; ubiquitin carrier protein L3; ubiquitin conjugating enzyme E2L 3; ubiquitin-conjugating enzyme E2-F1; ubiquitin-conjugating enzyme UBCH7; ubiquitin-protein ligase L3; EC 2.3.2.23
• Gene ID: 7332
• mRNA Refseq: NM_003347
• Protein Refseq: NP_003338
• MIM: 603721
• UniProt ID: P68036