Active Recombinant Full Length Human UBE2L3 Protein, C-Flag-tagged

• Cat.No.: UBE2L3-323HFL
• Product Overview: Recombinant Full Length Human UBE2L3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s) and ubiquitin-protein ligases (E3s). This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is demonstrated to participate in the ubiquitination of p53, c-Fos, and the NF-kB precursor p105 in vitro. Several alternatively spliced transcript variants have been found for this gene.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Bio-activity: ELISA capture for autoantibodies
• Molecular Mass: 17.7 kDa
• AA Sequence: MAASRRLMKELEEIRKCGMKNFRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITF KTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNA
  EEFTKKYGEKRPVDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Pathways: Parkinson's disease, Ubiquitin mediated proteolysis
• Full Length: Full L.

Gene Information

• Gene Name: UBE2L3 ubiquitin conjugating enzyme E2 L3 [ Homo sapiens (human) ]
• Official Symbol: UBE2L3
• Synonyms: E2-F1; L-UBC; UBCH7; UbcM4
• Gene ID: 7332
• mRNA Refseq: NM_003347.4
• Protein Refseq: NP_003338.1
• MIM: 603721
• UniProt ID: P68036