Active Recombinant Full Length Human TPX2 Protein, C-Flag-tagged

• Cat.No.: TPX2-222HFL
• Product Overview: Recombinant Full Length Human TPX2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Description: Spindle assembly factor required for normal assembly of mitotic spindles. Required for normal assembly of microtubules during apoptosis. Required for chromatin and/or kinetochore dependent microtubule nucleation. Mediates AURKA localization to spindle microtubules. Activates AURKA by promoting its autophosphorylation at 'Thr-288' and protects this residue against dephosphorylation. TPX2 is inactivated upon binding to importin-alpha. At the onset of mitosis, GOLGA2 interacts with importin-alpha, liberating TPX2 from importin-alpha, allowing TPX2 to activates AURKA kinase and stimulates local microtubule nucleation
• Source: Mammalian cells
• Species: Human
• Tag: Flag
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Bio-activity: TPX2 activity in a microtubule binding assay: SAF-A binds to MT in a TPX2-dependent manner. MT binding analysis of isolated SAF-A protein in the presence of different amounts of recombinant TPX2 protein. The lower panel shows western blotting with anti-SAF-A antibody. SAF-A co-pelleted with MT was increased, dependent on the amount of TPX2.
• Molecular Mass: 85.5 kDa
• AA Sequence: MSQVKSSYSYDAPSDFINFSSLDDEGDTQNIDSWFEEKANLENKLLGKNGTGGLFQGKTPLRKANLQQAI VTPLKPVDNTYYKEAEKENLVEQSIPSNACSSLEVEAAISRKTPAQPQRRSLRLSAQKDLEQKEKHHVKM KAKRCATPVIIDEILPSKKMKVSNNKKKPEEEGSAHQDTAEKNASSPEKAKGRHTVPCMPPAKQKFLKST EEQELEKSMKMQQEVVEMRKKNEEFKKLALAGIGQPVKKSVSQVTKSVDFHFRTDERIKQHPKNQEEYKE VNFTSELRKHPSSPARVTKGCTIVKPFNLSQGKKRTFDETVSTYVPLAQQVEDFHKRTPNRYHLRSKKDD INLLPSKSSVTKICRDPQTPVLQTKHRARAVTCKSTAELEAEELEKLQQYKFKARELDPRILEGGPILPK KPPVKPPTEPIGFDLEIEKRIQERESKKKTEDEHFEFHSRPCPTKILEDVVGVPEKKVLPITVPKSPAFA LKNRIRMPTKEDEEEDEPVVIKAQPVPHYGVPFKPQIPEARTVEICPFSFDSRDKERQLQKEKKIKELQK GEVPKFKALPLPHFDTINLPEKKVKNVTQIEPFCLETDRRGALKAQTWKHQLEEELRQQKEAACFKARPN TVISQEPFVPKKEKKSVAEGLSGSLVQEPFQLATEKRAKERQELEKRMAEVEAQKAQQLEEARLQEEEQK
  KEELARLRRELVHKANPIRKYQGLEIKSSDQPLTVPVSPKFSTRFHCTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Druggable Genome, Stem cell - Pluripotency
• Full Length: Full L.

Gene Information

• Gene Name: TPX2 TPX2 microtubule nucleation factor [ Homo sapiens (human) ]
• Official Symbol: TPX2
• Synonyms: DIL2; p100; DIL-2; HCTP4; FLS353; HCA519; REPP86; C20orf1; C20orf2; GD:C20orf1
• Gene ID: 22974
• mRNA Refseq: NM_012112.5
• Protein Refseq: NP_036244.2
• MIM: 605917
• UniProt ID: Q9ULW0