Active Recombinant Full Length Human TBX21 Protein, C-Flag-tagged
Cat.No. : | TBX21-125HFL |
Product Overview : | Recombinant Full Length Human TBX21 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene is the human ortholog of mouse Tbx21/Tbet gene. Studies in mouse show that Tbx21 protein is a Th1 cell-specific transcription factor that controls the expression of the hallmark Th1 cytokine, interferon-gamma (IFNG). Expression of the human ortholog also correlates with IFNG expression in Th1 and natural killer cells, suggesting a role for this gene in initiating Th1 lineage development from naive Th precursor cells. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Enzyme substrate |
Molecular Mass : | 58.1 kDa |
AA Sequence : | MGIVEPGCGDMLTGTEPMPGSDEGRAPGADPQHRYFYPEPGAQDADERRGGGSLGSPYPGGALVPAPPSR FLGAYAYPPRPQAAGFPGAGESFPPPADAEGYQPGEGYAAPDPRAGLYPGPREDYALPAGLEVSGKLRVA LNNHLLWSKFNQHQTEMIITKQGRRMFPFLSFTVAGLEPTSHYRMFVDVVLVDQHHWRYQSGKWVQCGKA EGSMPGNRLYVHPDSPNTGAHWMRQEVSFGKLKLTNNKGASNNVTQMIVLQSLHKYQPRLHIVEVNDGEP EAACNASNTHIFTFQETQFIAVTAYQNAEITQLKIDNNPFAKGFRENFESMYTSVDTSIPSPPGPNCQFL GGDHYSPLLPNQYPVPSRFYPDLPGQAKDVVPQAYWLGAPRDHSYEAEFRAVSMKPAFLPSAPGPTMSYY RGQEVLAPGAGWPVAPQYPPKMGPASWFRPMRTLPMEPGPGGSEGRGPEDQGPPLVWTEIAPIRPESSDS GLGEGDSKRRRVSPYPSSGDSSSPAGAPSPFDKEAEGQFYNYFPNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transcription Factors |
Full Length : | Full L. |
Gene Name | TBX21 T-box transcription factor 21 [ Homo sapiens (human) ] |
Official Symbol | TBX21 |
Synonyms | TBET; IMD88; T-PET; T-bet; TBLYM |
Gene ID | 30009 |
mRNA Refseq | NM_013351.2 |
Protein Refseq | NP_037483.1 |
MIM | 604895 |
UniProt ID | Q9UL17 |
◆ Recombinant Proteins | ||
TBX21-3141H | Recombinant Human TBX21, GST-tagged | +Inquiry |
Tbx21-1498M | Recombinant Mouse Tbx21 protein, His & T7-tagged | +Inquiry |
TBX21-5839H | Recombinant Human TBX21 Protein (Met11-Asn535), C-His tagged | +Inquiry |
TBX21-3024H | Recombinant Human TBX21 protein, His-tagged | +Inquiry |
TBX21-2143H | Recombinant Human TBX21 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
TBX21-1747HCL | Recombinant Human TBX21 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TBX21 Products
Required fields are marked with *
My Review for All TBX21 Products
Required fields are marked with *
0
Inquiry Basket