Active Recombinant Full Length Human SLC25A5 Protein, C-Flag-tagged

• Cat.No.: SLC25A5-300HFL
• Product Overview: Recombinant Full Length Human SLC25A5 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: This gene is a member of the mitochondrial carrier subfamily of solute carrier protein genes. The product of this gene functions as a gated pore that translocates ADP from the cytoplasm into the mitochondrial matrix and ATP from the mitochondrial matrix into the cytoplasm. The protein forms a homodimer embedded in the inner mitochondria membrane. Suppressed expression of this gene has been shown to induce apoptosis and inhibit tumor growth. The human genome contains several non-transcribed pseudogenes of this gene.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Bio-activity: Pull-down assay
• Molecular Mass: 32.7 kDa
• AA Sequence: MTDAAVSFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQGVLSF WRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASGGAAGATSLCFVYPLDFARTR LAADVGKAGAEREFRGLGDCLVKIYKSDGIKGLYQGFNVSVQGIIIYRAAYFGIYDTAKGMLPDPKNTHI VISWMIAQTVTAVAGLTSYPFDTVRRRMMMQSGRKGTDIMYTGTLDCWRKIARDEGGKAFFKGAWSNVLR
  GMGGAFVLVLYDEIKKYTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Calcium signaling pathway, Huntington's disease, Parkinson's disease
• Full Length: Full L.

Gene Information

• Gene Name: SLC25A5 solute carrier family 25 member 5 [ Homo sapiens (human) ]
• Official Symbol: SLC25A5
• Synonyms: T2; T3; 2F1; AAC2; ANT2
• Gene ID: 292
• mRNA Refseq: NM_001152.5
• Protein Refseq: NP_001143.2
• MIM: 300150
• UniProt ID: P05141