Active Recombinant Full Length Human SCG2 Protein, C-Flag-tagged
Cat.No. : | SCG2-485HFL |
Product Overview : | Recombinant Full Length Human SCG2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a member of the chromogranin/secretogranin family of neuroendocrine secretory proteins. Studies in rodents suggest that the full-length protein, secretogranin II, is involved in the packaging or sorting of peptide hormones and neuropeptides into secretory vesicles. The full-length protein is cleaved to produce the active peptide secretoneurin, which exerts chemotaxic effects on specific cell types, and EM66, whose function is unknown. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Cell treatment |
Molecular Mass : | 70.8 kDa |
AA Sequence : | MAEAKTHWLGAALSLIPLIFLISGAEAASFQRNQLLQKEPDLRLENVQKFPSPEMIRALEYIENLRQQAH KEESSPDYNPYQGVSVPLQQKENGDESHLPERDSLSEEDWMRIILEALRQAENEPQSAPKENKPYALNSE KNFPMDMSDDYETQQWPERKLKHMQFPPMYEENSRDNPFKRTNEIVEEQYTPQSLATLESVFQELGKLTG PNNQKRERMDEEQKLYTDDEDDIYKANNIAYEDVVGGEDWNPVEEKIESQTQEEVRDSKENIEKNEQIND EMKRSGQLGIQEEGLRKESKDQLSDDVSKVIAYLKRLVNAAGSGRLQNGQNGERATRLFEKPLDSQSIYQ LIEISRNLQIPPEDLIEMLKTGEKPNGSVEPERELDLPVDLDDISEADLDHPDLFQNRMLSKSGYPKTPG GAGTEALPDGLSVEDILNLLGMESAANQKTSYFPNPYNQEKVLPRLPYGAGRSRSNQLPKAAWIPHVENR QMAYENLNDKDQELGEYLARMLVKYPEIINSNQVKRVPGQGSSEGDLQEEEQIEQAIKEHLNQGSSQETD KLAPVSKRFPVGPPKNDDTPNRQYWDEDLLMKVLEYLNQEKAEKGREHIAKRAMENMTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Secreted Protein, Transmembrane |
Full Length : | Full L. |
Gene Name | SCG2 secretogranin II [ Homo sapiens (human) ] |
Official Symbol | SCG2 |
Synonyms | SN; CHGC; EM66; SgII |
Gene ID | 7857 |
mRNA Refseq | NM_003469.5 |
Protein Refseq | NP_003460.2 |
MIM | 118930 |
UniProt ID | P13521 |
◆ Recombinant Proteins | ||
SCG2-643C | Recombinant Cynomolgus Monkey SCG2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SCG2-2648H | Recombinant Human SCG2 protein(261-380 aa), C-His-tagged | +Inquiry |
SCG2-2525H | Recombinant Human SCG2, GST-tagged | +Inquiry |
SCG2-5249R | Recombinant Rat SCG2 Protein | +Inquiry |
Scg2-5707M | Recombinant Mouse Scg2 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SCG2-788HCL | Recombinant Human SCG2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SCG2 Products
Required fields are marked with *
My Review for All SCG2 Products
Required fields are marked with *
0
Inquiry Basket