Active Recombinant Full Length Human RPS6KB1 Protein, C-Flag-tagged
Cat.No. : | RPS6KB1-233HFL |
Product Overview : | Recombinant Full Length Human RPS6KB1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the ribosomal S6 kinase family of serine/threonine kinases. The encoded protein responds to mTOR (mammalian target of rapamycin) signaling to promote protein synthesis, cell growth, and cell proliferation. Activity of this gene has been associated with human cancer. Alternatively spliced transcript variants have been observed. The use of alternative translation start sites results in isoforms with longer or shorter N-termini which may differ in their subcellular localizations. There are two pseudogenes for this gene on chromosome 17. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | EMSA reaction |
Molecular Mass : | 59 kDa |
AA Sequence : | MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVGPYELGMEHCE KFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIFAMKVLKKAMIVRNAKDTAHT KAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLH QKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLG ALMYDMLTGAPPFTGENRKKTIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHP FFRHINWEELLARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLE SVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSGIEQMDVTMSG EASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protein Kinase |
Protein Pathways : | Acute myeloid leukemia, ErbB signaling pathway, Fc gamma R-mediated phagocytosis, Insulin signaling pathway, mTOR signaling pathway, TGF-beta signaling pathway |
Full Length : | Full L. |
Gene Name | RPS6KB1 ribosomal protein S6 kinase B1 [ Homo sapiens (human) ] |
Official Symbol | RPS6KB1 |
Synonyms | S6K; PS6K; S6K1; STK14A; p70-S6K; p70 S6KA; p70-alpha; S6K-beta-1; p70(S6K)-alpha |
Gene ID | 6198 |
mRNA Refseq | NM_003161.4 |
Protein Refseq | NP_003152.1 |
MIM | 608938 |
UniProt ID | P23443 |
◆ Recombinant Proteins | ||
RPS6KB1-8524H | Recombinant Human RPS6KB1 protein(Met1-Leu525), GST-tagged | +Inquiry |
RPS6KB1-376H | Recombinant Full Length Human RPS6KB1, His-tagged, Active | +Inquiry |
RPS6KB1-3185H | Recombinant Human RPS6KB1 Protein (Phe91-Phe352), His tagged | +Inquiry |
RPS6KB1-1153H | Recombinant Human RPS6KB1 Protein (R2-L525), GST tagged | +Inquiry |
RPS6KB1-1915H | Recombinant Human RPS6KB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPS6KB1-001HCL | Recombinant Human RPS6KB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RPS6KB1 Products
Required fields are marked with *
My Review for All RPS6KB1 Products
Required fields are marked with *
0
Inquiry Basket