Active Recombinant Full Length Human PGLYRP2 Protein, C-Flag-tagged
Cat.No. : | PGLYRP2-87HFL |
Product Overview : | Recombinant Full Length Human PGLYRP2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a peptidoglycan recognition protein, which belongs to the N-acetylmuramoyl-L-alanine amidase 2 family. This protein hydrolyzes the link between N-acetylmuramoyl residues and L-amino acid residues in bacterial cell wall glycopeptides, and thus may play a scavenger role by digesting biologically active peptidoglycan into biologically inactive fragments. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Cell treatment |
Molecular Mass : | 62 kDa |
AA Sequence : | MAQGVLWILLGLLLWSDPGTASLPLLMDSVIQALAELEQKVPAAKTRHTASAWLMSAPNSGPHNRLYHFL LGAWSLNATELDPCPLSPELLGLTKEVARHDVREGKEYGVVLAPDGSTVAVEPLLAGLEAGLQGRRVINL PLDSMAAPWETGDTFPDVVAIAPDVRATSSPGLRDGSPDVTTADIGANTPDATKGCPDVQASLPDAKAKS PPTMVDSLLAVTLAGNLGLTFLRGSQTQSHPDLGTEGCWDQLSAPRTFTLLDPKASLLTMAFLNGALDGV ILGDYLSRTPEPRPSLSHLLSQYYGAGVARDPGFRSNFRRQNGAALTSASILAQQVWGTLVLLQRLEPVH LQLQCMSQEQLAQVAANATKEFTEAFLGCPAIHPRCRWGAAPYRGRPKLLQLPLGFLYVHHTYVPAPPCT DFTRCAANMRSMQRYHQDTQGWGDIGYSFVVGSDGYVYEGRGWHWVGAHTLGHNSRGFGVAIVGNYTAAL PTEAALRTVRDTLPSCAVRAGLLRPDYALLGHRQLVRTDCPGDALFDLLRTWPHFTATVKPRPARSVSKR SRREPPPRTLPATDLQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Secreted Protein |
Full Length : | Full L. |
Gene Name | PGLYRP2 peptidoglycan recognition protein 2 [ Homo sapiens (human) ] |
Official Symbol | PGLYRP2 |
Synonyms | tagL; PGRPL; PGRP-L; PGLYRPL; HMFT0141; TAGL-like; tagl-beta; tagL-alpha |
Gene ID | 114770 |
mRNA Refseq | NM_052890.4 |
Protein Refseq | NP_443122.3 |
MIM | 608199 |
UniProt ID | Q96PD5 |
◆ Recombinant Proteins | ||
Pglyrp2-4822M | Recombinant Mouse Pglyrp2 Protein, Myc/DDK-tagged | +Inquiry |
PGLYRP2-1700H | Recombinant Human PGLYRP2 Protein (22-576 aa), His-tagged | +Inquiry |
PGLYRP2-87HFL | Active Recombinant Full Length Human PGLYRP2 Protein, C-Flag-tagged | +Inquiry |
PGLYRP2-1662H | Recombinant Human PGLYRP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PGLYRP2-1091H | Recombinant Human PGLYRP2 Protein (22-576 aa), His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PGLYRP2-3254HCL | Recombinant Human PGLYRP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PGLYRP2 Products
Required fields are marked with *
My Review for All PGLYRP2 Products
Required fields are marked with *
0
Inquiry Basket