Active Recombinant Full Length Human PFN1 Protein, C-Flag-tagged

• Cat.No.: PFN1-624HFL
• Product Overview: Recombinant Full Length Human PFN1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: This gene encodes a member of the profilin family of small actin-binding proteins. The encoded protein plays an important role in actin dynamics by regulating actin polymerization in response to extracellular signals. Deletion of this gene is associated with Miller-Dieker syndrome, and the encoded protein may also play a role in Huntington disease. Multiple pseudogenes of this gene are located on chromosome 1.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Bio-activity: Pull-down assay
• Molecular Mass: 14.9 kDa
• AA Sequence: MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQK CSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQYTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Druggable Genome, Stem cell - Pluripotency
• Protein Pathways: Regulation of actin cytoskeleton
• Full Length: Full L.

Gene Information

• Gene Name: PFN1 profilin 1 [ Homo sapiens (human) ]
• Official Symbol: PFN1
• Synonyms: ALS18
• Gene ID: 5216
• mRNA Refseq: NM_005022.4
• Protein Refseq: NP_005013.1
• MIM: 176610
• UniProt ID: P07737