Active Recombinant Full Length Human PFN1 Protein, C-Flag-tagged
Cat.No. : | PFN1-624HFL |
Product Overview : | Recombinant Full Length Human PFN1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the profilin family of small actin-binding proteins. The encoded protein plays an important role in actin dynamics by regulating actin polymerization in response to extracellular signals. Deletion of this gene is associated with Miller-Dieker syndrome, and the encoded protein may also play a role in Huntington disease. Multiple pseudogenes of this gene are located on chromosome 1. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Pull-down assay |
Molecular Mass : | 14.9 kDa |
AA Sequence : | MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQK CSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQYTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Stem cell - Pluripotency |
Protein Pathways : | Regulation of actin cytoskeleton |
Full Length : | Full L. |
Gene Name | PFN1 profilin 1 [ Homo sapiens (human) ] |
Official Symbol | PFN1 |
Synonyms | ALS18 |
Gene ID | 5216 |
mRNA Refseq | NM_005022.4 |
Protein Refseq | NP_005013.1 |
MIM | 176610 |
UniProt ID | P07737 |
◆ Recombinant Proteins | ||
PFN1-115H | Recombinant Human PFN1 protein, T7/His-tagged | +Inquiry |
Pfn1-4812M | Recombinant Mouse Pfn1 Protein, Myc/DDK-tagged | +Inquiry |
PFN1-527C | Recombinant Cynomolgus Monkey PFN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PFN1-4873H | Recombinant Human PFN1 Protein (Met1-Gln139), His tagged | +Inquiry |
PFN1-429H | Recombinant Human PFN1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PFN1-3269HCL | Recombinant Human PFN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PFN1 Products
Required fields are marked with *
My Review for All PFN1 Products
Required fields are marked with *
0
Inquiry Basket