Active Recombinant Full Length Human OCRL Protein, C-Flag-tagged
Cat.No. : | OCRL-459HFL |
Product Overview : | Recombinant Full Length Human OCRL Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes an inositol polyphosphate 5-phosphatase. This protein is involved in regulating membrane trafficking and is located in numerous subcellular locations including the trans-Golgi network, clathrin-coated vesicles and, endosomes and the plasma membrane. This protein may also play a role in primary cilium formation. Mutations in this gene cause oculocerebrorenal syndrome of Lowe and also Dent disease. Alternate splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Enzyme activity |
Molecular Mass : | 104 kDa |
AA Sequence : | MEPPLPVGAQPLATVEGMEMKGPLREPCALTLAQRNGQYELIIQLHEKEQHVQDIIPINSHFRCVQEAEE TLLIDIASNSGCKIRVQGDWIRERRFEIPDEEHCLKFLSAVLAAQKAQSQLLVPEQKDSSSWYQKLDTKD KPSVFSGLLGFEDNFSSMNLDKKINSQNQPTGIHREPPPPPFSVNKMLPREKEASNKEQPKVTNTMRKLF VPNTQSGQREGLIKHILAKREKEYVNIQTFRFFVGTWNVNGQSPDSGLEPWLNCDPNPPDIYCIGFQELD LSTEAFFYFESVKEQEWSMAVERGLHSKAKYKKVQLVRLVGMMLLIFARKDQCRYIRDIATETVGTGIMG KMGNKGGVAVRFVFHNTTFCIVNSHLAAHVEDFERRNQDYKDICARMSFVVPNQTLPQLNIMKHEVVIWL GDLNYRLCMPDANEVKSLINKKDLQRLLKFDQLNIQRTQKKAFVDFNEGEIKFIPTYKYDSKTDRWDSSG KCRVPAWCDRILWRGTNVNQLNYRSHMELKTSDHKPVSALFHIGVKVVDERRYRKVFEDSVRIMDRMEND FLPSLELSRREFVFENVKFRQLQKEKFQISNNGQVPCHFSFIPKLNDSQYCKPWLRAEPFEGYLEPNETV DISLDVYVSKDSVTILNSGEDKIEDILVLHLDRGKDYFLTISGNYLPSCFGTSLEALCRMKRPIREVPVT KLIDLEEDSFLEKEKSLLQMVPLDEGASERPLQVPKEIWLLVDHLFKYACHQEDLFQTPGMQEELQQIID CLDTSIPETIPGSNHSVAEALLIFLEALPEPVICYELYQRCLDSAYDPRICRQVISQLPRCHRNVFRYLM AFLRELLKFSEYNSVNANMIATLFTSLLLRPPPNLMARQTPSDRQRAIQFLLGFLLGSEEDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Inositol phosphate metabolism, Metabolic pathways, Phosphatidylinositol signaling system |
Full Length : | Full L. |
Gene Name | OCRL OCRL inositol polyphosphate-5-phosphatase [ Homo sapiens (human) ] |
Official Symbol | OCRL |
Synonyms | LOCR; DENT2; NPHL2; OCRL1; Dent-2; INPP5F; OCRL-1 |
Gene ID | 4952 |
mRNA Refseq | NM_000276.4 |
Protein Refseq | NP_000267.2 |
MIM | 300535 |
UniProt ID | Q01968 |
◆ Recombinant Proteins | ||
MANEA-3209R | Recombinant Rat MANEA Protein, His (Fc)-Avi-tagged | +Inquiry |
C1QTNF7-236H | Recombinant Human C1QTNF7, His-tagged | +Inquiry |
CLHC1-1753M | Recombinant Mouse CLHC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SMS-8501M | Recombinant Mouse SMS Protein, His (Fc)-Avi-tagged | +Inquiry |
DAZ4-2356H | Recombinant Human DAZ4 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
TSH-25H | Active Native Human Thyroid Stimulating Hormone protein | +Inquiry |
ACPP-8250H | Native Human Prostatic Acid Phosphatase | +Inquiry |
HSP90AA1-14H | Native Hsp90 Protein | +Inquiry |
CFD-348H | Active Native Human Factor D | +Inquiry |
Lectin-1826P | Active Native Phaseolus Vulgaris Leucoagglutinin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARL10-8723HCL | Recombinant Human ARL10 293 Cell Lysate | +Inquiry |
WDR74-335HCL | Recombinant Human WDR74 293 Cell Lysate | +Inquiry |
SLC26A7-1751HCL | Recombinant Human SLC26A7 293 Cell Lysate | +Inquiry |
PPIF-2970HCL | Recombinant Human PPIF 293 Cell Lysate | +Inquiry |
NHLH2-3832HCL | Recombinant Human NHLH2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OCRL Products
Required fields are marked with *
My Review for All OCRL Products
Required fields are marked with *
0
Inquiry Basket