Active Recombinant Full Length Human NEU2 Protein, C-Flag-tagged

• Cat.No.: NEU2-95HFL
• Product Overview: Recombinant Full Length Human NEU2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Description: This gene belongs to a family of glycohydrolytic enzymes which remove sialic acid residues from glycoproteins and glycolipids. Expression studies in COS7 cells confirmed that this gene encodes a functional sialidase. Its cytosolic localization was demonstrated by cell fractionation experiments.
• Source: Mammalian cells
• Species: Human
• Tag: Flag
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Bio-activity: Cell treatment
• Molecular Mass: 42.1 kDa
• AA Sequence: MASLPVLQKESVFQSGAHAYRIPALLYLPGQQSLLAFAEQRASKKDEHAELIVLRRGDYDAPTHQVQWQA QEVVAQARLDGHRSMNPCPLYDAQTGTLFLFFIAIPGQVTEQQQLQTRANVTRLCQVTSTDHGRTWSSPR DLTDAAIGPAYREWSTFAVGPGHCLQLNDRARSLVVPAYAYRKLHPIQRPIPSAFCFLSHDHGRTWARGH FVAQDTLECQVAEVETGEQRVVTLNARSHLRARVQAQSTNDGLDFQESQLVKKLVEPPPQGCQGSVISFP SPRSGPGSPAQWLLYTHPTHSWQRADLGAYLNPRPPAPEAWSEPVLLAKGSCAYSDLQSMGTGPDGSPLF
  GCLYEANDYEEIVFLMFTLKQAFPAEYLPQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Pathways: Other glycan degradation, Sphingolipid metabolism
• Full Length: Full L.

Gene Information

• Gene Name: NEU2 neuraminidase 2 [ Homo sapiens (human) ]
• Official Symbol: NEU2
• Synonyms: SIAL2
• Gene ID: 4759
• mRNA Refseq: NM_005383.2
• Protein Refseq: NP_005374.2
• MIM: 605528
• UniProt ID: Q9Y3R4