Active Recombinant Full Length Human NASP Protein, C-Flag-tagged
Cat.No. : | NASP-585HFL |
Product Overview : | Recombinant Full Length Human NASP Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a H1 histone binding protein that is involved in transporting histones into the nucleus of dividing cells. Multiple isoforms are encoded by transcript variants of this gene. The somatic form is expressed in all mitotic cells, is localized to the nucleus, and is coupled to the cell cycle. The testicular form is expressed in embryonic tissues, tumor cells, and the testis. In male germ cells, this protein is localized to the cytoplasm of primary spermatocytes, the nucleus of spermatids, and the periacrosomal region of mature spermatozoa. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Enzyme substrate |
Molecular Mass : | 85.1 kDa |
AA Sequence : | MAMESTATAAVAAELVSADKIEDVPAPSTSADKVESLDVDSEAKKLLGLGQKHLVMGDIPAAVNAFQEAA SLLGKKYGETANECGEAFFFYGKSLLELARMENGVLGNALEGVHVEEEEGEKTEDESLVENNDNIDEEAR EELREQVYDAMGEKEEAKKTEDKSLAKPETDKEQDSEMEKGGREDMDISKSAEEPQEKVDLTLDWLTETS EEAKGGAAPEGPNEAEVTSGKPEQEVPDAEEEKSVSGTDVQEECREKGGQEKQGEVIVSIEEKPKEVSEE QPVVTLEKQGTAVEVEAESLDPTVKPVDVGGDEPEEKVVTSENEAGKAVLEQLVGQEVPPAEESPEVTTE AAEASAVEAGSEVSEKPGQEAPVLPKDGAVNGPSVVGDQTPIEPQTSIERLTETKDGSGLEEKVRAKLVP SQEETKLSVEESEAAGDGVDTKVAQGATEKSPEDKVQIAANEETQEREEQMKEGEETEGSEEDDKENDKT EEMPNDSVLENKSLQENEEEEIGNLELAWDMLDLAKIIFKRQETKEAQLYAAQAHLKLGEVSVESENYVQ AVEEFQSCLNLQEQYLEAHDRLLAETHYQLGLAYGYNSQYDEAVAQFSKSIEVIENRMAVLNEQVKEAEG SSAEYKKEIEELKELLPEIREKIEDAKESQRSGNVAELALKATLVESSTSGFTPGGGGSSVSMIASRKPT DGASSSNCVTDISHLVRKKRKPEEESPRKDDAKKAKQEPEVNGGSGDAVPSGNEVSENMEEEAENQAESR AAVEGTVEAGATVESTACTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | NASP nuclear autoantigenic sperm protein [ Homo sapiens (human) ] |
Official Symbol | NASP |
Synonyms | HMDRA1; FLB7527; PRO1999 |
Gene ID | 4678 |
mRNA Refseq | NM_002482.4 |
Protein Refseq | NP_002473.2 |
MIM | 603185 |
UniProt ID | P49321 |
◆ Recombinant Proteins | ||
RFL30727AF | Recombinant Full Length Arabidopsis Thaliana Casp-Like Protein At2G36330(At2G36330) Protein, His-Tagged | +Inquiry |
Adam10-961M | Active Recombinant Mouse Adam10 Protein, His-tagged | +Inquiry |
MLANA-2043H | Recombinant Human Melan-A | +Inquiry |
MANBAL-2657R | Recombinant Rhesus monkey MANBAL Protein, His-tagged | +Inquiry |
AMHR2-0488H | Recombinant Human AMHR2 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
SERPINA7-30623TH | Native Human SERPINA7 | +Inquiry |
Tenascin-112H | Native Human Tenascin | +Inquiry |
IgA-259H | Native Human Secretory Immunoglobulin A | +Inquiry |
BCHE-5291H | Native Human Butyrylcholinesterase | +Inquiry |
Colon-009H | Human Colon Lysate, Total Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DPAB17737 | Rabbit Anti-TELO2 Polyclonal Antibody | +Inquiry |
WDYHV1-324HCL | Recombinant Human WDYHV1 293 Cell Lysate | +Inquiry |
ZNF346-2016HCL | Recombinant Human ZNF346 cell lysate | +Inquiry |
ABCF2-9144HCL | Recombinant Human ABCF2 293 Cell Lysate | +Inquiry |
CHCHD7-7542HCL | Recombinant Human CHCHD7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NASP Products
Required fields are marked with *
My Review for All NASP Products
Required fields are marked with *
0
Inquiry Basket