Active Recombinant Full Length Human LACC1 Protein, C-Flag-tagged
Cat.No. : | LACC1-445HFL |
Product Overview : | Recombinant Full Length Human LACC1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes an oxidoreductase that promotes fatty-acid oxidation, with concomitant inflammasome activation, mitochondrial and NADPH-oxidase-dependent reactive oxygen species production, and bactericidal activity of macrophages. The encoded protein forms a complex with fatty acid synthase on peroxisomes and is thought to be modulated by peroxisome proliferator-activated receptor signaling events. Naturally occurring mutations in this gene are associated with inflammatory bowel disease, Behcet's disease, leprosy, ulcerative colitis, early-onset Crohn's disease, and systemic juvenile idiopathic arthritis. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Enzyme activity |
Molecular Mass : | 47.6 kDa |
AA Sequence : | MAEAVLIDLFGLKLNSQKNCHQTLLKTLNAVQYHHAAKAKFLCIMCCSNISYERDGEQDNCEIETSNGLS ALLEEFEIVSCPSMAATLYTIKQKIDEKNLSSIKVIVPRHRKTLMKAFIDQLFTDVYNFEFEDLQVTFRG GLFKQSIEINVITAQELRGIQNEIETFLRSLPALRGKLTIITSSLIPDIFIHGFTTRTGGISYIPTLSSF NLFSSSKRRDPKVVVQENLRRLANAAGFNVEKFYRIKTHHSNDIWIMGRKEPDSYDGITTNQRGVTIAAL GADCIPIVFADPVKKACGVAHAGWKGTLLGVAMATVNAMIAEYGCSLEDIVVVLGPSVGPCCFTLPRESA EAFHNLHPACVQLFDSPNPCIDIRKATRILLEQGGILPQNIQDQNQDLNLCTSCHPDKFFSHVRDGLNFG TQIGFISIKETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | LACC1 laccase domain containing 1 [ Homo sapiens (human) ] |
Official Symbol | LACC1 |
Synonyms | FAMIN; JUVAR; C13orf31 |
Gene ID | 144811 |
mRNA Refseq | NM_153218.4 |
Protein Refseq | NP_694950.2 |
MIM | 613409 |
UniProt ID | Q8IV20 |
◆ Recombinant Proteins | ||
LACC1-3068H | Recombinant Human LACC1 protein, His-tagged | +Inquiry |
Lacc1-3746M | Recombinant Mouse Lacc1 Protein, Myc/DDK-tagged | +Inquiry |
LACC1-1273H | Recombinant Human LACC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
LACC1-445HFL | Active Recombinant Full Length Human LACC1 Protein, C-Flag-tagged | +Inquiry |
LACC1-1338H | Recombinant Human LACC1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
LACC1-8298HCL | Recombinant Human C13orf31 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LACC1 Products
Required fields are marked with *
My Review for All LACC1 Products
Required fields are marked with *
0
Inquiry Basket