Active Recombinant Full Length Human KLF4 Protein, C-Flag-tagged
Cat.No. : | KLF4-271HFL |
Product Overview : | Recombinant Full Length Human KLF4 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a protein that belongs to the Kruppel family of transcription factors. The encoded zinc finger protein is required for normal development of the barrier function of skin. The encoded protein is thought to control the G1-to-S transition of the cell cycle following DNA damage by mediating the tumor suppressor gene p53. Mice lacking this gene have a normal appearance but lose weight rapidly, and die shortly after birth due to fluid evaporation resulting from compromised epidermal barrier function. Alternative splicing results in multiple transcript variants encoding different isoforms. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | EMSA assay |
Molecular Mass : | 49.9 kDa |
AA Sequence : | MAVSDALLPSFSTFASGPAGREKTLRQAGAPNNRWREELSHMKRLPPVLPGRPYDLAAATVATDLESGGA GAACGGSNLAPLPRRETEEFNDLLDLDFILSNSLTHPPESVAATVSSSASASSSSSPSSSGPASAPSTCS FTYPIRAGNDPGVAPGGTGGGLLYGRESAPPPTAPFNLADINDVSPSGGFVAELLRPELDPVYIPPQQPQ PPGGGLMGKFVLKASLSAPGSEYGSPSVISVSKGSPDGSHPVVVAPYNGGPPRTCPKIKQEAVSSCTHLG AGPPLSNGHRPAAHDFPLGRQLPSRTTPTLGLEEVLSSRDCHPALPLPPGFHPHPGPNYPSFLPDQMQPQ VPPLHYQELMPPGSCMPEEPKPKRGRRSWPRKRTATHTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCD WDGCGWKFARSDELTRHYRKHTGHRPFQCQKCDRAFSRSDHLALHMKRHFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Adult stem cells, Embryonic stem cells, ES Cell Differentiation/IPS, Induced pluripotent stem cells, Transcription Factors |
Full Length : | Full L. |
Gene Name | KLF4 KLF transcription factor 4 [ Homo sapiens (human) ] |
Official Symbol | KLF4 |
Synonyms | EZF; GKLF |
Gene ID | 9314 |
mRNA Refseq | NM_004235.6 |
Protein Refseq | NP_004226.3 |
MIM | 602253 |
UniProt ID | O43474 |
◆ Recombinant Proteins | ||
KLF4-8466H | Recombinant Human KLF4, His-tagged | +Inquiry |
Klf4-5856M | Recombinant Mouse Klf4 protein, His & T7-tagged | +Inquiry |
KLF4-2236R | Recombinant Rhesus Macaque KLF4 Protein, His (Fc)-Avi-tagged | +Inquiry |
KLF4-2415R | Recombinant Rhesus monkey KLF4 Protein, His-tagged | +Inquiry |
KLF4-1250H | Recombinant Human KLF4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KLF4-4927HCL | Recombinant Human KLF4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KLF4 Products
Required fields are marked with *
My Review for All KLF4 Products
Required fields are marked with *
0
Inquiry Basket