Active Recombinant Full Length Human IL23A Protein, C-Flag-tagged

• Cat.No.: IL23A-600HFL
• Product Overview: Recombinant Full Length Human IL23A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: This gene encodes a subunit of the heterodimeric cytokine interleukin 23 (IL23). IL23 is composed of this protein and the p40 subunit of interleukin 12 (IL12B). The receptor of IL23 is formed by the beta 1 subunit of IL12 (IL12RB1) and an IL23 specific subunit, IL23R. Both IL23 and IL12 can activate the transcription activator STAT4, and stimulate the production of interferon-gamma (IFNG). In contrast to IL12, which acts mainly on naive CD4(+) T cells, IL23 preferentially acts on memory CD4(+) T cells.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Bio-activity: Protease substrate
  Cell treatment
  MS digestion
• Molecular Mass: 18.6 kDa
• AA Sequence: MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPH IQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGH
  HWETQQMPSLSPSQPWQRLLLRFKILRNLQAFVAVAARVFAHGAATLSPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway
• Full Length: Full L.

Gene Information

• Gene Name: IL23A interleukin 23 subunit alpha [ Homo sapiens (human) ]
• Official Symbol: IL23A
• Synonyms: P19; SGRF; IL-23; IL-23A; IL23P19
• Gene ID: 51561
• mRNA Refseq: NM_016584.3
• Protein Refseq: NP_057668.1
• MIM: 605580
• UniProt ID: Q9NPF7

Q&As

Is this bioactive cyno IL-23 heterodimer (p19/p40) or just the cyno IL-23p19 subunit?

Please inquiry our product manager with specific product.