Active Recombinant Full Length Human IL23A Protein, C-Flag-tagged
Cat.No. : | IL23A-109HFL |
Product Overview : | Recombinant Full Length Human IL23A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a subunit of the heterodimeric cytokine interleukin 23 (IL23). IL23 is composed of this protein and the p40 subunit of interleukin 12 (IL12B). The receptor of IL23 is formed by the beta 1 subunit of IL12 (IL12RB1) and an IL23 specific subunit, IL23R. Both IL23 and IL12 can activate the transcription activator STAT4, and stimulate the production of interferon-gamma (IFNG). In contrast to IL12, which acts mainly on naive CD4(+) T cells, IL23 preferentially acts on memory CD4(+) T cells. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Protease substrate Cell treatment MS digestion |
Molecular Mass : | 18.6 kDa |
AA Sequence : | MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPH IQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGH HWETQQMPSLSPSQPWQRLLLRFKILRNLQAFVAVAARVFAHGAATLSPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Secreted Protein |
Protein Pathways : | Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway |
Full Length : | Full L. |
Gene Name | IL23A interleukin 23 subunit alpha [ Homo sapiens (human) ] |
Official Symbol | IL23A |
Synonyms | P19; SGRF; IL-23; IL-23A; IL23P19 |
Gene ID | 51561 |
mRNA Refseq | NM_016584.3 |
Protein Refseq | NP_057668.1 |
MIM | 605580 |
UniProt ID | Q9NPF7 |
◆ Recombinant Proteins | ||
IL23A-2303H | Recombinant Human IL23A Protein, His-tagged | +Inquiry |
IL23A-01H | Active Recombinant Human IL23A Protein, Myc/DDK-tagged | +Inquiry |
IL23A-2696R | Recombinant Rat IL23A Protein, His (Fc)-Avi-tagged | +Inquiry |
IL23A-4845H | Recombinant Human IL23A Protein (Arg20-Pro189), C-Fc tagged | +Inquiry |
IL23A-29781TH | Recombinant Human IL23A, FLAG-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL23A-5231HCL | Recombinant Human IL23A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (1)
Ask a question
Is this bioactive cyno IL-23 heterodimer (p19/p40) or just the cyno IL-23p19 subunit?
02/01/2023
Please inquiry our product manager with specific product.
Ask a Question for All IL23A Products
Required fields are marked with *
My Review for All IL23A Products
Required fields are marked with *
0
Inquiry Basket