Active Recombinant Full Length Human FYN Protein, C-Flag-tagged

• Cat.No.: FYN-822HFL
• Product Overview: Recombinant Full Length Human FYN Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: This gene is a member of the protein-tyrosine kinase oncogene family. It encodes a membrane-associated tyrosine kinase that has been implicated in the control of cell growth. The protein associates with the p85 subunit of phosphatidylinositol 3-kinase and interacts with the fyn-binding protein. Alternatively spliced transcript variants encoding distinct isoforms exist.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Bio-activity: FYN activity verified in a biochemical assay: FYN (FYN oncogene related to SRC, FGR, YES) activity was measured in a homogeneous time-resolved fluorescent (HTRF®) assay. FYN is a non-receptor tyrosine kinase and is a member of the Src kinase family consisting of Src, Fyn, Yes, Lck, Lyn, Hck, Fgr and Blk. Varying concentrations of FYN were added to a reaction mix containing ATP and a biotinylated kinase substrate and the reaction mixture was incubated to allow the protein to phosphorylate the substrate. HTRF detection reagents were then added, and the time-resolved fluorescent signal was measured on a Flexstation 3 microplate reader. The time resolved fluorescent signal is expressed as “delta R” or “&DeltaR” and is a ratio calculated from the fluorescent emission intensities of the donor and acceptor fluors.
• Molecular Mass: 60.6 kDa
• AA Sequence: MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQGLTVFGGVNSS SHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAP VDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDN GGYYITTRAQFETLQQLVQHYSERAAGLCCRLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNG QFGEVWMGTWNGNTKVAIKTLKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMNKGSL LDFLKDGEGRALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEY TARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVERGYRMPCPQD
  CPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGENLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Druggable Genome, Protein Kinase
• Protein Pathways: Adherens junction, Axon guidance, Fc epsilon RI signaling pathway, Focal adhesion, Natural killer cell mediated cytotoxicity, Pathogenic Escherichia coli infection, Prion diseases, T cell receptor signaling pathway, Viral myocarditis
• Full Length: Full L.

Gene Information

• Gene Name: FYN FYN proto-oncogene, Src family tyrosine kinase [ Homo sapiens (human) ]
• Official Symbol: FYN
• Synonyms: SLK; SYN; p59-FYN
• Gene ID: 2534
• mRNA Refseq: NM_002037.5
• Protein Refseq: NP_002028.1
• MIM: 137025
• UniProt ID: P06241