Active Recombinant Full Length Human FLT3LG Protein, C-Flag-tagged

• Cat.No.: FLT3LG-916HFL
• Product Overview: Recombinant Full Length Human FLT3LG Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: Dendritic cells (DCs) provide the key link between innate and adaptive immunity by recognizing pathogens and priming pathogen-specific immune responses. FLT3LG controls the development of DCs and is particularly important for plasmacytoid DCs and CD8 (see MIM 186910)-positive classical DCs and their CD103-positive tissue counterparts.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Bio-activity: FLT-3LG generate dendritic cell differentiation: Fms-like tyrosine kinase 3 ligand (Flt3L) is a nonredundant cytokine required for dendritic cell (DC) homeostasis in lymphoid tissues. FLT3L is commonly used to generate pDCs in vitro.In this experiment, 300,000 unfractioned mouse bone marrow cells were cultured with purified recombinant human FLT-3L at indicated concentrations. Total live cells were counted at the day 8.
• Molecular Mass: 26.2 kDa
• AA Sequence: MTVLAPAWSPTTYLLLLLLLSSGLSGTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELC GGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVA LKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQPPLLLLLLLPVGLLLLAAAWCLHWQRT
  RRRTPRPGEQVPPVPSPQDLLLVEHTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein, Transmembrane
• Protein Pathways: Cytokine-cytokine receptor interaction, Hematopoietic cell lineage, Pathways in cancer
• Full Length: Full L.

Gene Information

• Gene Name: FLT3LG fms related receptor tyrosine kinase 3 ligand [ Homo sapiens (human) ]
• Official Symbol: FLT3LG
• Synonyms: FL; FLG3L; FLT3L
• Gene ID: 2323
• mRNA Refseq: NM_001459.4
• Protein Refseq: NP_001450.2
• MIM: 600007
• UniProt ID: P49771