Active Recombinant Full Length Human EEF1G Protein, C-Flag-tagged
Cat.No. : | EEF1G-566HFL |
Product Overview : | Recombinant Full Length Human EEF1G Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This subunit contains an N-terminal glutathione transferase domain, which may be involved in regulating the assembly of multisubunit complexes containing this elongation factor and aminoacyl-tRNA synthetases. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Biolayer interferometry (BLI) assay |
Molecular Mass : | 49.9 kDa |
AA Sequence : | MAAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVF ESNAIAYYVSNEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHHNKQATENAKEEVRRILG LLDAYLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWFLTCINQPQFRAVLGEVKLC EKMAQFDAKKFAETQPKKDTPRKEKGSREEKQKPQAERKEEKKAAAPAPEEEMDECEQALAAEPKAKDPF AHLPKSTFVLDEFKRKYSNEDTLSVALPYFWEHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQRLD KLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWE GAFQHVGKAFNQGKIFKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | EEF1G eukaryotic translation elongation factor 1 gamma [ Homo sapiens (human) ] |
Official Symbol | EEF1G |
Synonyms | EF1G; GIG35 |
Gene ID | 1937 |
mRNA Refseq | NM_001404.5 |
Protein Refseq | NP_001395.1 |
MIM | 130593 |
UniProt ID | P26641 |
◆ Recombinant Proteins | ||
EEF1G-566HFL | Active Recombinant Full Length Human EEF1G Protein, C-Flag-tagged | +Inquiry |
EEF1G-4222C | Recombinant Chicken EEF1G | +Inquiry |
EEF1G-1385R | Recombinant Rhesus monkey EEF1G Protein, His-tagged | +Inquiry |
EEF1G-4210HF | Recombinant Full Length Human EEF1G Protein, GST-tagged | +Inquiry |
EEF1G-9535Z | Recombinant Zebrafish EEF1G | +Inquiry |
◆ Cell & Tissue Lysates | ||
EEF1G-6712HCL | Recombinant Human EEF1G 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EEF1G Products
Required fields are marked with *
My Review for All EEF1G Products
Required fields are marked with *
0
Inquiry Basket