Active Recombinant Full Length Human CLIC2 Protein, C-Flag-tagged

• Cat.No.: CLIC2-403HFL
• Product Overview: Recombinant Full Length Human CLIC2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Description: This gene encodes a chloride intracellular channel protein. Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. This protein plays a role in inhibiting the function of ryanodine receptor 2. A mutation in this gene is the cause of an X-linked form of cognitive disability.
• Source: Mammalian cells
• Species: Human
• Tag: Flag
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Bio-activity: ELISA capture for autoantibodies
• Molecular Mass: 28.2 kDa
• AA Sequence: MSGLRPGTQVDPEIELFVKAGSDGESIGNCPFCQRLFMILWLKGVKFNVTTVDMTRKPEELKDLAPGTNP PFLVYNKELKTDFIKIEEFLEQTLAPPRYPHLSPKYKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSLL KEFKRLDDYLNTPLLDEIDPDSAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFS
  GVWRYLHNAYAREEFTHTCPEDKEIENTYANVAKQKSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Druggable Genome, Ion Channels: Other
• Full Length: Full L.

Gene Information

• Gene Name: CLIC2 chloride intracellular channel 2 [ Homo sapiens (human) ]
• Official Symbol: CLIC2
• Synonyms: CLCNL2; CLIC2b; MRXS32; XAP121
• Gene ID: 1193
• mRNA Refseq: NM_001289.6
• Protein Refseq: NP_001280.3
• MIM: 300138
• UniProt ID: O15247