Active Recombinant Full Length Human BECN1 Protein, C-Flag-tagged
Cat.No. : | BECN1-161HFL |
Product Overview : | Recombinant Full Length Human BECN1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a protein that regulates autophagy, a catabolic process of degradation induced by starvation. The encoded protein is a component of the phosphatidylinositol-3-kinase (PI3K) complex which mediates vesicle-trafficking processes. This protein is thought to play a role in multiple cellular processes, including tumorigenesis, neurodegeneration and apoptosis. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Enzyme substrate |
Molecular Mass : | 51.7 kDa |
AA Sequence : | MEGSKTSNNSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFI ETPRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEEC TDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQLQMELKELALEEERLIQELEDVEKNRKIVAE NLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSG QFGTINNFRLGRLPSVPVEWNEINAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELP LYCSGGLRFFWDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFN SEEQWTKALKFMLTNLKWGLAWVSSQFYNKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Regulation of autophagy |
Full Length : | Full L. |
Gene Name | BECN1 beclin 1 [ Homo sapiens (human) ] |
Official Symbol | BECN1 |
Synonyms | ATG6; VPS30; beclin1 |
Gene ID | 8678 |
mRNA Refseq | NM_003766.5 |
Protein Refseq | NP_003757.1 |
MIM | 604378 |
UniProt ID | Q14457 |
◆ Recombinant Proteins | ||
BECN1-10203H | Recombinant Human BECN1, GST-tagged | +Inquiry |
BECN1-0745H | Recombinant Human BECN1 Protein | +Inquiry |
Becn1-1855M | Recombinant Mouse Becn1 Protein, Myc/DDK-tagged | +Inquiry |
BECN1-294H | Recombinant Human BECN1 protein, His/MBP-tagged | +Inquiry |
BECN1-295H | Recombinant Human BECN1 protein, His/MBP-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BECN1-8470HCL | Recombinant Human BECN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BECN1 Products
Required fields are marked with *
My Review for All BECN1 Products
Required fields are marked with *
0
Inquiry Basket