Active Recombinant Full Length Human AKR1C3 Protein, His tagged

• Cat.No.: AKR1C3-26146TH
• Product Overview: Active recombinant human AKR1C3 protein, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques.

Specification

• Description: This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme catalyzes the reduction of prostaglandin (PG) D2, PGH2 and phenanthrenequinone (PQ), and the oxidation of 9alpha,11beta-PGF2 to PGD2. It may play an important role in the pathogenesis of allergic diseases such as asthma, and may also have a role in controlling cell growth and/or differentiation. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14. Three transcript variants encoding different isoforms have been found for this gene.
• Source: E. coli
• Species: Human
• Tag: N-His
• Protein length: 1-323 aa
• Form: Liquid
• Molecular Mass: 39 kDa (343aa) confirmed by MALDI-TOF
• AA Sequence: < MGSSHHHHHHSSGLVPRGSH> MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEY
• Bio-Activity: Specific activity is > 1,000 pmol/min/μg, and is defined as the amount of enzyme that catalyze the oxidation of 1.0 pmole 1-Acenaphthenol in the presence of NADP per minute at pH 8.8 at 25 centigrade.
• Endotoxin: < 1 EU/μg by LAL.
• Purity: > 95 % by SDS-PAGE
• Applications: SDS-PAGE, Enzyme Activity
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Storage Buffer: 20mM Tris-HCl buffer (pH 8.0) containing 10 % glycerol
• Concentration: 1 mg/mL (determined by Bradford assay)
• Reference: 1. Davies N., et al. (2009) Cancer Res. 69(11):4769-75
  2. Kabututu Z., et al. (2009) J Biochem. 145(2):161-8

Gene Information

• Gene Name: AKR1C3 aldo-keto reductase family 1 member C3 [ Homo sapiens (human) ]
• Official Symbol: AKR1C3
• Synonyms: AKR1C3; aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II); HSD17B5, hydroxysteroid (17 beta) dehydrogenase 5; aldo-keto reductase family 1 member C3; DDX; dihydrodiol dehydrogenase X; HAKRB; KIAA0119; PGFS; prostaglandin F synthase; indanol dehydrogenase; 3-alpha-HSD type II, brain; dihydrodiol dehydrogenase 3; chlordecone reductase homolog HAKRb; testosterone 17-beta-dehydrogenase 5; type IIb 3-alpha hydroxysteroid dehydrogenase; trans-1,2-dihydrobenzene-1,2-diol dehydrogenase; DD3; HAKRe; HA1753; HSD17B5; hluPGFS
• Gene ID: 8644
• mRNA Refseq: NM_003739
• Protein Refseq: NP_003730
• MIM: 603966
• UniProt ID: P42330