Active Recombinant Dog IL1A Protein, His-tagged

• Cat.No.: IL1A-011D
• Product Overview: Recombinant canine IL-1 alpha /IL-1F1, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.

Specification

• Species: Dog
• Source: Insect cells
• Tag: His
• Description: Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
• Form: Liquid
• Bio-activity: Measured in a cell proliferation assay using D10.G4.1 mouse helper T cell. The ED50 range ≤ 2 ng/mL.
• Molecular Mass: 19.3 kDa
• AA Sequence: SVAYNFHNNEKYNYIRIIKSQFILNDNLNQSIVRQTGGNYLMTAALQNLDDAVKFDMGAYTSEDSKLPVTLRISKTRLFVSAQNEDEPVLLKEMPETPKTIRDETNLLFFWERHGSKHYFKSVAQPKLFIATQERKLVHMARGQPSITDFRLLETQP
• Endotoxin: < 1 EU/μg of protein (determined by LAL method)
• Purity: > 90% by SDS-PAGE
• Applications: SDS-PAGE, Bioactivity
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -90 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 0.25 mg/mL (determined by Absorbance at 280nm)
• Storage Buffer: Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol

Gene Information

• Gene Name: IL1A interleukin 1 alpha [ Canis lupus familiaris (dog) ]
• Official Symbol: IL1A
• Synonyms: IL1A; interleukin 1 alpha; interleukin-1 alpha; IL-1 alpha
• Gene ID: 403782
• mRNA Refseq: NM_001003157
• Protein Refseq: NP_001003157
• UniProt ID: O46612