Active Recombinant Aspergillus flavus Urate Oxidase, Tag Free

• Cat.No.: UOX-13A
• Product Overview: Urate Oxidase Recombinant produced in E. coli is a tetrameric, non-glycosylated polypeptide chain containing 302 amino acids. The cDNA coding for urate-oxidase was cloned from a strain of Aspergillus flavus. The monomer protein has no intra- or inter-disulfide bridges.

Specification

• Species: Aspergillus flavus
• Source: E.coli
• Tag: Non
• Description: Urate oxidase catalyzes the enzymatic oxidation (degrades) of uric acid into allantoin, an inactive and soluble metabolite, which is 5 to 10 fold more soluble than uric acid. Urate oxidase is an enzyme of the purine breakdown pathway that catalyses the oxidation of uric acid to allantoin. Uricase is present in numerous diverse organisms, but not in higher primates including human. Hyperuricaemia is most commonly associated with gout and also occurs in mammalians with malignancy, especially those with lymphoid malignancies due to rapid cell turnover and an increased rate of purine metabolism. Uricase is effective in the prevention and treatment of hyperuricaemia in mammalians with malignancy and in those who have undergone transplantation. It appears to act rapidly, safely and induces a more dramatic decrease in plasma levels of uric acid.
• Tag: Non
• Form: Sterile Filtered White lyophilized (freeze-dried) powder
• Formula: C1523H2383N417O462S7
• Bio-activity: The specific activity was found to be 10 U/mg.
  One Unit oxidizes one micromole of uric acid per minute at 25 centigrade, at pH 8.5.
• Molecular Mass: 34,247 Dalton
• AA Sequence: msavkaarygkdnvrvykvhkdektgvqtvyemtvcvllegeietsytkadnsvivatdsikntiyitakqnpvtppelfgsilgthfiekynhihaahvnivchrwtrmdidgkphphsfirdseekrnvqvdvvegkgidiksslsgltvlkstnsqfwgflrdeyttlketwdrilstdvdatwqwknfsglqevrshvpkfdatwatarevtlktfaednsasvqatmykmaeqilarqqlietveyslpnkhyfeidlswhkglqntgknaevfapqsdpnglikctvgrsslkskl
• Purity: > 90% by SDS-PAGE
• Notes: Our products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
• Stability: Lyophilized Urate Oxidase although stable at room temperature for 3 weeks, should be stored desiccated below -18 centigrade. Upon reconstitution Uricase should be stored at 4 centigrade between 2-7 days and for future use below -18 centigrade.
  Please prevent freeze-thaw cycles.
• Storage Buffer: Each 1.5 mg Uricase contains 5 mg sucrose, 25 mg glycine, 0.1 mg Tween-80, 13.6 mg Na2HPO4*12H20 and 0.33 mg NaH2PO4*2H20.
• Reconstitution: We highly recommend reconstituting the lyophilized Uricase in 50mM borate buffer containing 0.001%Triton X-100 and 1.0mM EDTA, pH 8.5 for activity assay.
• Shipping: Shipped at Room temperature.

Gene Information

• Official Symbol: UOX
• Synonyms: Urate Oxidase; Uricase; Urate Oxygen; Oxidoreductase; UOX; UO; EC 1.7.3.