Active GMP Recombinant Porcine IL1B Protein, His-Tagged
Cat.No. : | IL1B-01P |
Product Overview : | GMP Recombinant Porcine IL1B Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Porcine |
Source : | E.coli |
Tag : | His |
Description : | Interleukin 1 beta (IL-1β) also known as leukocytic pyrogen, leukocytic endogenous mediator, mononuclear cell factor, lymphocyte activating factor and other names, is a cytokine protein that in humans is encoded by the IL1B gene. There are two genes for interleukin-1 (IL-1): IL-1 alpha and IL-1 beta (this gene). IL-1β precursor is cleaved by cytosolic caspase 1 (interleukin 1 beta convertase) to form mature IL-1β. |
Form : | Lyophilized |
Bio-activity : | Measure by its ability to induce D10.G4.1 cells proliferation. The ED50 for this effect is <3 ng/mL. |
AA Sequence : | MANVQSMECKLQDKDHKSLVLAGPHMLKALHLLTGDLKREVVFCMSFVQGDDSNNKIPVTLGIKGKNLYLSCVMKDNTPTLQLEDIDPKRYPKRDMEKRFVFYKTEIKNRVEFESALYPNWYISTSQAEQKPVFLGNSKGRQDITDFTMEVLSP with polyhistidine tag at the C-terminus |
Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
Purity : | >98% as determined by SDS-PAGE. Ni-NTA chromatography |
Notes : | Please use within one month after protein reconstitution. |
Storage : | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
Storage Buffer : | The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
Gene Name | IL1B interleukin 1 beta [ Sus scrofa (pig) ] |
Official Symbol | IL1B |
Synonyms | IL1B1 |
Gene ID | 397122 |
mRNA Refseq | NM_214055.1 |
Protein Refseq | NP_999220.1 |
UniProt ID | P26889 |
◆ Recombinant Proteins | ||
Il1b-55M | Active Recombinant Mouse Il1b Protein (Val118-Ser269), C-His tagged, Animal-free, Carrier-free | +Inquiry |
Il1b-384R | Recombinant Rat Il1b protein(Met1-Ser268), His-tagged | +Inquiry |
IL1B-60H | Recombinant Human IL1B protein, His-tagged | +Inquiry |
IL1B-3097H | Recombinant Human IL1B protein, GST-tagged | +Inquiry |
Il1b-7238M | Recombinant Mouse Il1b Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL1B-853HCL | Recombinant Human IL1B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL1B Products
Required fields are marked with *
My Review for All IL1B Products
Required fields are marked with *
0
Inquiry Basket