Active GMP Recombinant Porcine CSF2 Protein, His-Tagged

• Cat.No.: CSF2-01P
• Product Overview: GMP Recombinant Porcine CSF2 Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines.

Specification

• Species: Porcine
• Source: E.coli
• Tag: His
• Description: Granulocyte-macrophage colony-stimulating factor (GM-CSF), also known as colony-stimulating factor 2 (CSF2), is a monomeric glycoprotein secreted by macrophages, T cells, mast cells, natural killer cells, endothelial cells and fibroblasts that functions as a cytokine. GM-CSF also plays a role in embryonic development by functioning as an embryokine produced by reproductive tract.
• Form: Lyophilized
• Bio-activity: Measure by its ability to induce proliferation in TF-1 cells. The ED50 for this effect is <3 ng/mL.
• AA Sequence: APTRPPSPVTRPWQHVDAIKEALSLLNNSNDTAAVMNETVDVVCEMFDPQEPTCVQTRLNLYKQGLRGSLTRLKSPLTLLAKHYEQHCPLTEETSCETQSITFKSFKDSLNKFLFTIPFDCWGPVKK with polyhistidine tag at the N-terminus
• Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
• Purity: >98% as determined by SDS-PAGE. Ni-NTA chromatography
• Notes: Please use within one month after protein reconstitution.
• Storage: Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
• Storage Buffer: The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Gene Information

• Gene Name: CSF2 colony stimulating factor 2 [ Sus scrofa (pig) ]
• Official Symbol: CSF2
• Synonyms: GM-CSF
• Gene ID: 397208
• mRNA Refseq: NM_214118.2
• Protein Refseq: NP_999283.1
• UniProt ID: Q29118