Active GMP Recombinant Mouse Fgf2 Protein, His-Tagged

Cat.No. : Fgf2-01M
Product Overview : GMP Recombinant Mouse Fgf2 Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Description : Enables growth factor activity. Involved in stem cell development. Acts upstream of or within several processes, including animal organ development; positive regulation of macromolecule metabolic process; and positive regulation of signal transduction. Located in extracellular space. Is expressed in several structures, including alimentary system; central nervous system; extraembryonic component; genitourinary system; and sensory organ. Human ortholog(s) of this gene implicated in several diseases, including Parkinsonism; corneal neovascularization; diabetic neuropathy; gastric ulcer; and impotence. Orthologous to human FGF2 (fibroblast growth factor 2).
Form : Lyophilized
Bio-activity : Measure by its ability to induce 3T3 cells proliferation. The ED50 for this effect is <1.5 ng/mL. The specific activity of recombinant mouse FGF-2 is approximately >1x 10^6 IU/mg.
AA Sequence : ALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFF
FERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS with polyhistidine tag at the N-terminus
Endotoxin : <0.1 EU per 1 μg of the protein by the LAL method.
Purity : ≥98% as determined by SDS-PAGE and HPLC.
Purified by Ni-NTA chromatography.
Notes : Please use within one month after protein reconstitution.
Storage : Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
Storage Buffer : The protein was lyophilized from a solution containing 0.01% sarkosyl in 1X PBS, pH 8.0.
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Gene Name Fgf2 fibroblast growth factor 2 [ Mus musculus (house mouse) ]
Official Symbol Fgf2
Synonyms Fgfb; bFGF; Fgf-2; Fgf2a
Gene ID 14173
mRNA Refseq NM_008006.2
Protein Refseq NP_032032.1
UniProt ID P15655

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Fgf2 Products

Required fields are marked with *

My Review for All Fgf2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon