Active GMP Recombinant Mouse Fgf2 Protein, His-Tagged

• Cat.No.: Fgf2-01M
• Product Overview: GMP Recombinant Mouse Fgf2 Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines.

Specification

• Description: Enables growth factor activity. Involved in stem cell development. Acts upstream of or within several processes, including animal organ development; positive regulation of macromolecule metabolic process; and positive regulation of signal transduction. Located in extracellular space. Is expressed in several structures, including alimentary system; central nervous system; extraembryonic component; genitourinary system; and sensory organ. Human ortholog(s) of this gene implicated in several diseases, including Parkinsonism; corneal neovascularization; diabetic neuropathy; gastric ulcer; and impotence. Orthologous to human FGF2 (fibroblast growth factor 2).
• Source: Escherichia coli
• Species: Mouse
• Tag: His
• Form: Lyophilized
• Bio-activity: Measure by its ability to induce 3T3 cells proliferation. The ED50 for this effect is <1.5 ng/mL. The specific activity of recombinant mouse FGF-2 is approximately >1x 10^6 IU/mg.
• AA Sequence: ALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFF
  FERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS with polyhistidine tag at the N-terminus
• Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
• Purity: ≥98% as determined by SDS-PAGE and HPLC.
  Purified by Ni-NTA chromatography.
• Notes: Please use within one month after protein reconstitution.
• Storage: Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
• Storage Buffer: The protein was lyophilized from a solution containing 0.01% sarkosyl in 1X PBS, pH 8.0.
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Gene Information

• Gene Name: Fgf2 fibroblast growth factor 2 [ Mus musculus (house mouse) ]
• Official Symbol: Fgf2
• Synonyms: Fgfb; bFGF; Fgf-2; Fgf2a
• Gene ID: 14173
• mRNA Refseq: NM_008006.2
• Protein Refseq: NP_032032.1
• UniProt ID: P15655