Active GMP Recombinant Mouse Cxcl2 Protein, His-Tagged

• Cat.No.: Cxcl2-01M
• Product Overview: GMP Recombinant Mouse Cxcl2 Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Description: Predicted to enable CXCR chemokine receptor binding activity and chemokine activity. Involved in response to molecule of bacterial origin. Located in extracellular space. Is expressed in several structures, including alimentary system; embryo mesenchyme; floor plate; respiratory system; and skin. Orthologous to several human genes including CXCL3 (C-X-C motif chemokine ligand 3).
• Form: Lyophilized
• Bio-activity: Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED50 for this effect is <0.5 ng/mL.
• AA Sequence: AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN with polyhistidine tag at the N-terminus
• Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
• Purity: >98% as determined by SDS-PAGE. Ni-NTA chromatography
• Notes: Please use within one month after protein reconstitution.
• Storage: Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
• Storage Buffer: The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Gene Information

• Gene Name: Cxcl2 chemokine (C-X-C motif) ligand 2 [ Mus musculus (house mouse) ]
• Official Symbol: Cxcl2
• Synonyms: GROb; Gro2; Mip2; Scyb; MIP-2; Scyb2; MIP-2a; Mgsa-b; CINC-2a
• Gene ID: 20310
• mRNA Refseq: NM_009140.2
• Protein Refseq: NP_033166.1
• UniProt ID: P10889