Active GMP Recombinant Mouse Cxcl12 Protein, His-Tagged

• Cat.No.: Cxcl12-01M
• Product Overview: GMP Recombinant Mouse Cxcl12 Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines.

Specification

• Description: This gene encodes a member of the alpha chemokine protein family. The encoded protein is secreted and functions as the ligand for the G-protein coupled receptor, chemokine (C-X-C motif) receptor 4. The encoded protein plays a role in many diverse cellular functions, including embryogenesis, immune surveillance, inflammation response, tissue homeostasis, and tumor growth and metastasis. Alternative splicing results in multiple transcript variants.
• Source: Escherichia coli
• Species: Mouse
• Tag: His
• Form: Lyophilized
• Bio-activity: Measure by its ability to chemoattract BaF3 cells transfected with human CXCR4. The ED50 for this effect is <0.5 ng/mL.
• AA Sequence: MGKPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK with polyhistidine tag at the C-terminus
• Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
• Purity: >98% as determined by SDS-PAGE. Ni-NTA chromatography
• Notes: Please use within one month after protein reconstitution.
• Storage: Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
• Storage Buffer: The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Gene Information

• Gene Name: Cxcl12 chemokine (C-X-C motif) ligand 12 [ Mus musculus (house mouse) ]
• Official Symbol: Cxcl12
• Synonyms: Pbsf; Sdf1; Tlsf; Tpar1; Scyb12
• Gene ID: 20315
• mRNA Refseq: NM_001012477.2
• Protein Refseq: NP_001012495.1
• UniProt ID: A0A6P7RBN4