Active GMP Recombinant Mouse Cxcl11 Protein, His-Tagged
Cat.No. : | Cxcl11-01M |
Product Overview : | GMP Recombinant Mouse Cxcl11 Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | Predicted to enable CXCR chemokine receptor binding activity and chemokine activity. Predicted to be involved in several processes, including cellular response to lipopolysaccharide; chemokine-mediated signaling pathway; and neutrophil chemotaxis. Predicted to be active in extracellular space. Is expressed in head; nasal cavity epithelium; palatal shelf epithelium; palatal shelf mesenchyme; and testis. Orthologous to human CXCL11 (C-X-C motif chemokine ligand 11). |
Form : | Lyophilized |
Bio-activity : | Measure by its ability to chemoattract BaF3 cells transfected with human CXCR3. The ED50 for this effect is <10 ng/mL. |
AA Sequence : | FLMFKQGRCLCIGPGMKAVKMAEIEKASVIYPSNGCDKVEVIVTMKAHKRQRCLDPRSKQARLIMQAIEKKNFLRRQNM with polyhistidine tag at the N-terminus |
Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
Purity : | >98% as determined by SDS-PAGE. Ni-NTA chromatography |
Notes : | Please use within one month after protein reconstitution. |
Storage : | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
Storage Buffer : | The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
Gene Name | Cxcl11 chemokine (C-X-C motif) ligand 11 [ Mus musculus (house mouse) ] |
Official Symbol | Cxcl11 |
Synonyms | Ip9; H174; Itac; b-R1; Cxc11; I-tac; Scyb11; Scyb9b; betaR1 |
Gene ID | 56066 |
mRNA Refseq | NM_019494.1 |
Protein Refseq | NP_062367.1 |
UniProt ID | Q9JHH5 |
◆ Recombinant Proteins | ||
CXCL11-167H | Active Recombinant Human Chemokine (C-X-C Motif) Ligand 11, MIgG2a Fc-tagged | +Inquiry |
CXCL11-134B | Recombinant Bovine Chemokine (C-X-C motif) Ligand 11 | +Inquiry |
Cxcl11-2773H | Recombinant Hamster Cxcl11 Protein, His-tagged | +Inquiry |
Cxcl11-205R | Recombinant Rat Cxcl11 Protein, His/GST-tagged | +Inquiry |
CXCL11-280H | Recombinant Human CXCL11 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCL11-7171HCL | Recombinant Human CXCL11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Cxcl11 Products
Required fields are marked with *
My Review for All Cxcl11 Products
Required fields are marked with *
0
Inquiry Basket