Active GMP Recombinant Mouse Cxcl10 Protein, His-Tagged

• Cat.No.: Cxcl10-01M
• Product Overview: GMP Recombinant Mouse Cxcl10 Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Description: Predicted to enable chemoattractant activity; chemokine receptor binding activity; and heparin binding activity. Acts upstream of or within several processes, including defense response to virus; negative regulation of myoblast differentiation; and negative regulation of myoblast fusion. Located in external side of plasma membrane and extracellular space. Is expressed in several structures, including alimentary system; axial skeleton; hemolymphoid system; and liver. Human ortholog(s) of this gene implicated in hepatitis B; middle cerebral artery infarction; and type 1 diabetes mellitus. Orthologous to human CXCL10 (C-X-C motif chemokine ligand 10).
• Form: Lyophilized
• Bio-activity: Measure by its ability to chemoattract BaF3 cells transfected with human CXCR3. The ED50 for this effect is <0.2 μg/mL.
• AA Sequence: IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP with polyhistidine tag at the N-terminus
• Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
• Purity: >98% as determined by SDS-PAGE. Ni-NTA chromatography
• Notes: Please use within one month after protein reconstitution.
• Storage: Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
• Storage Buffer: The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Gene Information

• Gene Name: Cxcl10 chemokine (C-X-C motif) ligand 10 [ Mus musculus (house mouse) ]
• Official Symbol: Cxcl10
• Synonyms: C7; IP10; CRG-2; INP10; IP-10; Ifi10; mob-1; Scyb10; gIP-10
• Gene ID: 15945
• mRNA Refseq: NM_021274.2
• Protein Refseq: NP_067249.1
• UniProt ID: P17515