Active GMP Recombinant Mouse Ccl3 Protein, His-Tagged
Cat.No. : | Ccl3-01M |
Product Overview : | GMP Recombinant Mouse Ccl3 Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | Enables chemokine activity. Involved in several processes, including astrocyte cell migration; macrophage chemotaxis; and positive regulation of macromolecule metabolic process. Located in extracellular space. Is expressed in articular cartilage; cartilage; knee joint; lung; and radius. Human ortholog(s) of this gene implicated in human immunodeficiency virus infectious disease. Orthologous to several human genes including CCL3 (C-C motif chemokine ligand 3). |
Form : | Lyophilized |
Bio-activity : | Measure by its ability to chemoattract BaF3 cells transfected with human CCR5. The ED50 for this effect is <1.8 ng/mL. |
AA Sequence : | APYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA with polyhistidine tag at the N-terminus |
Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
Purity : | >98% as determined by SDS-PAGE. Ni-NTA chromatography |
Notes : | Please use within one month after protein reconstitution. |
Storage : | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
Storage Buffer : | The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
Gene Name | Ccl3 chemokine (C-C motif) ligand 3 [ Mus musculus (house mouse) ] |
Official Symbol | Ccl3 |
Synonyms | G0S19-1, LD78alpha, MIP-1alpha, MIP1-(a), MIP1-alpha, Mip1a, Scya3 |
Gene ID | 20302 |
mRNA Refseq | NM_011337.2 |
Protein Refseq | NP_035467.1 |
UniProt ID | P10855 |
◆ Recombinant Proteins | ||
CCL3-475H | Recombinant Human CCL3 protein, His-tagged | +Inquiry |
CCL3-151H | Recombinant Human CCL3 Protein, His-tagged | +Inquiry |
CCL3-1490H | Recombinant Human CCL3 Protein (Ala27-Ala92), N-GST tagged | +Inquiry |
CCL3-2975M | Recombinant Mouse CCL3 Protein | +Inquiry |
CCL3-4453H | Recombinant Human CCL3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL3-7723HCL | Recombinant Human CCL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ccl3 Products
Required fields are marked with *
My Review for All Ccl3 Products
Required fields are marked with *
0
Inquiry Basket