Active GMP Recombinant Human IL36A protein
Cat.No. : | IL36A-4338HG |
Product Overview : | Recombinant Human IL36A was produced in E. coli using non-animal reagents in an animal-free facility under cGMP guidelines. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Description : | Interleukin-36 (IL-36) is a pro-inflammatory cytokine which plays an important role in the pathophysiology of several diseases. IL-36α, IL-36β, and IL-36γ (formerly IL-1F6, IL-1F8, and IL-1F9) are IL-1 family members that signal through the IL-1 receptor family members IL-1Rrp2 (IL-1RL2) and IL-1RAcP. Studies showed IL-36α is mainly found in skin and lymphoid tissues, but also in fetal brain, trachea, stomach and intestine. Notably, IL-36 alpha is the only novel IL-1 family member expressed on T-cells. Recombinant human interleukin-36 alpha contains 158 amino acids residues which is a single non-glycosylated polypeptide and it is 30 % a.a. identical to IL-1ra, and 27 %, 31 %, 36 %, 46 %, 57% and 28 % a.a. identical to IL-1β, IL-36Ra/IL-1F5, IL-37/IL-1F7, IL-36β/IL-1F8, IL-36γ/IL-1F9 and IL-1F10. |
Form : | Lyophilized from a 0.2 μm filtered concentrated solution in 2 × PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The specific activity determined by its ability in a functional ELISA. Immobilized rHuIL-36α at 1 µg/mL can bind recombinant human IL-1 Rrp2 Fc Chimera with a range of 0.15-5 µg/mL. |
Molecular Mass : | Approximately 17.7 kDa, a single non-glycosylated polypeptide chain containing 158 amino acids. |
AA Sequence : | MEKALKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF |
Endotoxin : | Less than 1 EU/μg of rHuIL-36α, 158a.a. as determined by LAL method. |
Purity : | > 95 % by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably des centigradecated. Upon reconsitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 centigrade to -70 centigrade. Avoid repeated freeze/thaw centigrade centigradeles. |
Reconstitution : | Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Quality Statement : | Our GMP proteins are produced according to relevant sections of the following documents: WHO TRS, No. 822, 1992 Annex 1, Good Manufacturing Practices for Biological Products; USP Chapter 1043, Ancillary Materials for Cell, Gene and Tissue-Engineered Products and USP Chapter 92, Growth Factors and Cytokines Used in Cell Therapy Manufacturing. |
Shipping : | The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature. |
Gene Name | IL36A interleukin 36, alpha [ Homo sapiens (human) ] |
Official Symbol | IL36A |
Synonyms | FIL1; FIL1E; IL1F6; IL-1F6; IL1(EPSILON); FIL1(EPSILON) |
Gene ID | 27179 |
mRNA Refseq | NM_014440.2 |
Protein Refseq | NP_055255.1 |
MIM | 605509 |
UniProt ID | Q9UHA7 |
◆ Recombinant Proteins | ||
IL36A-507H | Active Recombinant Human IL36A protein(Ala6-Phe158) | +Inquiry |
IL1F6-158H | Recombinant Human Interleukin 1 Family, Member 6, His-tagged | +Inquiry |
IL36A-506H | Recombinant Human IL36A protein | +Inquiry |
IL1F6-317H | Recombinant Human IL1F6 | +Inquiry |
IL36A-3515H | Recombinant Human IL36A Protein (Met1-Phe158), His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL36A-5238HCL | Recombinant Human IL1F6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL36A Products
Required fields are marked with *
My Review for All IL36A Products
Required fields are marked with *
0
Inquiry Basket