Recombinant Zebrafish VWC2L Protein (22-223 aa), His-Myc-tagged

• Cat.No.: VWC2L-2465Z
• Product Overview: Recombinant Zebrafish (Danio rerio) (Brachydanio rerio) VWC2L Protein (22-223 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the C-terminal and a Myc tag at the C-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Species: Zebrafish
• Source: Yeast
• Tag: His&Myc
• Protein Length: 22-223 aa
• Description: May play a role in bone differentiation and matrix mineralization. May play a role in neural development.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 25.4 kDa
• AA Sequence: ASVGPEDYPAADEAERTANNDIIFDDYRGKGCVDDSGFVYKLGERFFPGHSNCPCVCTEDGPVCDQPECPKIHPKCTKVEHNGCCPECKEVKNFCEYRGKTYKILEEFKPSPCEWCRCEPNNEVHCVVADCAVPECVNPVYEPEQCCPICKNGPNCFAGTTIIPAGIEVKVDDCTICRCHSGDWWKPAQCLRRECLNGQATS
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: vwc2l von Willebrand factor C domain containing 2 like [ Danio rerio (zebrafish) ]
• Official Symbol: VWC2L
• Synonyms: vwc2l; si:ch211-207d8.1
• Gene ID: 100148652
• mRNA Refseq: NM_001128564
• Protein Refseq: NP_001122036
• UniProt ID: B0UZC8