Recombinant Zebrafish sod1 Protein, His-SUMO/MYC-tagged
Cat.No. : | sod1-1373Z |
Product Overview : | Recombinant Zebrafish sod1 Protein (1-154aa) was expressed in E. coli with N-terminal His-SUMO and C-terminal MYC tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Zebrafish |
Source : | E.coli |
Tag : | His&Myc&SUMO |
ProteinLength : | 1-154 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 37.1 kDa |
AA Sequence : | MVNKAVCVLKGTGEVTGTVYFNQEGEKKPVKVTGEITGLTPGKHGFHVHAFGDNTNGCISAGPHFNPHDK THGGPTDSVRHVGDLGNVTADASGVAKIEIEDAMLTLSGQHSIIGRTMVIHEKEDDLGKGGNEESLKTGN AGGRLACGVIGITQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | sod1 superoxide dismutase 1, soluble [ Danio rerio (zebrafish) ] |
Official Symbol | sod1 |
Synonyms | ZSOD; cuzn; Cu/Zn-SOD; sod1 |
Gene ID | 30553 |
mRNA Refseq | NM_131294.1 |
Protein Refseq | NP_571369.1 |
UniProt ID | O73872 |
◆ Recombinant Proteins | ||
AMOTL2-84654H | Recombinant Human AMOTL2 protein, His-tagged | +Inquiry |
ST6GAL2-4026C | Recombinant Chicken ST6GAL2 | +Inquiry |
FRS3-2394R | Recombinant Rat FRS3 Protein | +Inquiry |
ACE-32H | Active Recombinant Human ACE2 Protein, His-tagged, Alexa Fluor® 647 conjugated | +Inquiry |
GZMB-2634H | Recombinant Human GZMB protein, His & T7-tagged | +Inquiry |
◆ Native Proteins | ||
AMBP-27H | Native Human AMBP | +Inquiry |
PROC-64H | Active Native Human Activated Protein C | +Inquiry |
HBsAg-ad-21H | Native Human HBsAg protein (Subtype ad) | +Inquiry |
Immunoglobulin G4-84H | Native Human Immunoglobulin G4 | +Inquiry |
TF-31158TH | Native Human TF | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAIM3-753HCL | Recombinant Human FAIM3 cell lysate | +Inquiry |
SP140-1675HCL | Recombinant Human SP140 cell lysate | +Inquiry |
TC2N-1195HCL | Recombinant Human TC2N 293 Cell Lysate | +Inquiry |
APBB3-8800HCL | Recombinant Human APBB3 293 Cell Lysate | +Inquiry |
SYT2-646HCL | Recombinant Human SYT2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All sod1 Products
Required fields are marked with *
My Review for All sod1 Products
Required fields are marked with *
0
Inquiry Basket