Recombinant Vibrio Parahaemolyticus Serotype O3:K6 OMPK Protein (21-266 aa), His-SUMO-tagged

Cat.No. : OMPK-1885V
Product Overview : Recombinant Vibrio Parahaemolyticus Serotype O3:K6 (strain RIMD 2210633) OMPK Protein (21-266 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Vibrio Parahaemolyticus Serotype O3:K6
Source : E.coli
Tag : His&SUMO
Protein Length : 21-266 aa
Description : Serves as receptor for a broad-host-range vibriophage, KVP40.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 43.9 kDa
AA Sequence : ADYSDGDIHKNDYKWMQFNLMGAFDELPGESSHDYLEMEFGGRSGIFDLYGYVDVFNLASDKGSDKVGDPKIFMKFAPRMSIDGLTGKDLSFGPVQELYVATLFEWDGTDYKTNPFSVNNQKVGIGSDVMVPWFGKVGVNLYGTYQGNQKDWNGFQISTNWFKPFYFFENGSFISYQGYIDYQFGMKEKYSSASNGGAMFNGIYWHSDRFAVGYGLKGYKDVYGIKDSDALKSTGFGHYVAVTYKF
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Synonyms ompK;
UniProt ID P59570

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All OMPK Products

Required fields are marked with *

My Review for All OMPK Products

Required fields are marked with *

0

Inquiry Basket

cartIcon