Recombinant VACV Envelope H3L Protein

• Cat.No.: H3L-01V
• Product Overview: Recombinant full length Vaccinia virus (strain Copenhagen) Envelope H3L Protein

Specification

• Species: VACV
• ProteinLength: 1-324
• Description: Envelope protein that binds to heparan sulfate on the cell surface and might provide virion attachment to target cell.
• AA Sequence: MAAVKTPVIVVPVIDRPPSETFPNVHEHINDQKFDDVKDNEVMPEKRNVVVVKDDPDHYKDYAFIQWTGGNIRNDDKYTHFFSGFCNTMCTEETKRNIARHLALWDSNFFTELENKKVEYVVIVENDNVIEDITFLRPVLKAMHDKKIDILQMREIITGNKVKTELVMDKNHTIFTYTGGYDVSLSAYIIRVTTALNIVDEIIKSGGLSSGFYFEIARIENEMKINRQILDNAAKYVEHDPRLVAEHRFENMKPNFWSRIGTAAAKRYPGVMYAFTTPLISFFGLFDINVIGLIVILFIM FMLIFNVKSKLLWFLTGTFVTAFI
• Stability: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: Store at -20 centigrade, for extended storage, conserve at -20 or -80 centigrade.
• Storage Buffer: Tris-based buffer, 50% glycerol, optimized for this protein

Gene Information

• Gene Name: H3L temporal expression: late [ Vaccinia virus ]
• Official Symbol: H3L
• Synonyms: Envelope protein H3; Ag35; Virion envelope protein p35; H3L; temporal expression: late; IMV heparin binding surface protein; similar to VACCP-H3L; involved in IMV maturation
• Gene ID: 3707557
• Protein Refseq: YP_232983
• UniProt ID: P20497