Recombinant Trypanosoma brucei Tb09.211.3050 Protein, GST/His-tagged

• Cat.No.: Tb09.211.3050-17T
• Product Overview: Recombinant Trypanosoma brucei Tb09.211.3050 Protein, fused to GST/His-tag, was expressed in E. coli.

Specification

• Species: Trypanosoma brucei
• Source: E.coli
• Tag: His&GST
• Description: hypothetical protein
• Form: Liquid. In 50 mM Tris-HCl, 150 mM NaCl, pH 8.0.
• Molecular Mass: ~42 kDa
• AA Sequence: MRSAVNLGGAPRVPSQRLPAFEGVSPRIVARQVPAHRGEYVSLVLRPTSLNAQRNSLVASCVVTDESVEVMGLPADAEVAQVNEFVCYINPSSGELEYYQHGTYNDEYDVDVYRKLLELCPKFPALF
• Purity: >80%
• Storage: Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles.
• Concentration: 0.07 mg/ml

Gene Information

• Gene Name: Tb09.211.3050 hypothetical protein [ Trypanosoma brucei brucei TREU927 ]
• Official Symbol: Tb09.211.3050
• Gene ID: 3660907
• mRNA Refseq: XM_822357
• Protein Refseq: XP_827450
• UniProt ID: Q38DK0