Recombinant Toxocara Canis TES26 Protein (22-262 aa), His-tagged

• Cat.No.: TES26-2794T
• Product Overview: Recombinant Toxocara Canis (Canine roundworm) TES26 Protein (22-262 aa) is produced by Baculovirus expression system. This protein is fused with a 9xHis tag at the C-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Species: Toxocara Canis
• Source: Insect Cells
• Tag: His
• ProteinLength: 22-262 aa
• Description: Binds phosphatidylethanolamine.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 27.9 kDa
• AA Sequence: QCMDSASDCAANAGSCFTRPVSQVLQNRCQRTCNTCDCRDEANNCAASINLCQNPTFEPLVRDRCQKTCGLCAGCGFISSGIVPLVVTSAPSRRVSVTFANNVQVNCGNTLTTAQVANQPTVTWEAQPNDRYTLIMVDPDFPSAANGQQGQRLHWWVINIPGNNIAGGTTLAAFQPSTPAANTGVHRYVFLVYRQPAAINSPLLNNLVVQDSERPGFGTTAFATQFNLGSPYAGNFYRSQA
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Synonyms: TES-26
• UniProt ID: P54190