Recombinant Swine TNF alpha
Cat.No. : | TNFa-24S |
Product Overview : | Swine TNF alpha was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pig |
Source : | Yeast |
Tag : | Non |
Description : | Tumor necrosis factor alpha (TNFSF2) is a member of the TNF Superfamily. It is produced chiefly by activated macrophages, but it is produced also by a broad variety of cell types including lymphoid cells, mast cells, endothelial cells, cardiac myocytes, adipose tissue, fibroblasts, and neuronal tissue. The primary role of TNF alpha is in the regulation of immune cells. TNF alpha, being an endogenous pyrogen, is able to induce fever, to induce apoptotic cell death, to induce sepsis (through IL-1 & IL-6 production), to induce cachexia, induce inflammation, and to inhibit tumorigenesis and viral replication. |
Form : | Lyophilized |
Molecular Mass : | 16.9 kDa |
AA Sequence : | SSSQTSDKPVAHVVANVKAEGQLQWQSGYANALLANGVKLKDNQLVVPTDGLYLIYSQVLFRGQGCPSTNVFLTH TISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKDDRLSAEINLPDYLDFAESGQVYFG IIAL |
Applications : | The Swine TNF alpha protein can be used in cell culture, as an TNF alpha ELISA Standard, and as a Western Blot |
Storage : | -20 C |
◆ Recombinant Proteins | ||
TNF-39H | Active Recombinant Human TNFa | +Inquiry |
TNFa-34G | Recombinant Guinea Pig TNF alpha | +Inquiry |
TNFA-386H | Recombinant Human TNFA protein, GST-tagged | +Inquiry |
TNFa-89O | Recombinant Ovine TNF alpha | +Inquiry |
TNFa-4389A | Recombinant Atlantic Salmon TNFa Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TNFa Products
Required fields are marked with *
My Review for All TNFa Products
Required fields are marked with *
0
Inquiry Basket