Recombinant Staphylococcus epidermidis (strain ATCC 12228) folA protein, His-tagged

• Cat.No.: folA-4259S
• Product Overview: Recombinant Staphylococcus epidermidis (strain ATCC 12228) folA protein(P0C0P1)(1-161aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Staphylococcus Epidermidis
• Source: E.coli
• Tag: His
• ProteinLength: 1-161aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 22.0 kDa
• AA Sequence: MTLSIIVAHDKQRVIGYQNQLPWHLPNDLKHVKQLTTGNTLVMGRKTFNSIGKPLPNRRNVVLTNQASFHHEGVDVINSLDEIKELSGHVFIFGGQTLFEAMIDQVDDMYITVIDGKFQGDTFFPPYTFENWEVESSVEGQLDEKNTIPHTFLHLVRRKGK
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.