Recombinant SPE196 Protein
Cat.No. : | SPE196-61 |
Product Overview : | Recombinant SPE196 Protein |
Availability | February 08, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Source : | E.coli |
Molecular Mass : | The protein has a calculated MW of 22 kDa. |
AA Sequence : | MTSFSGVQGTYWGSSQWANGNCKFQDWPQPNGLPTAAVAGNLYSGAKYCGACIDVTSKAGITKRGIISDNCPGCPSNALDLSPDLWNSVTNNESPGIETLNWKIVDCGYTSPISLITKDGVTVSWFAMQAAGHNEPISSLEVKPAGGSTWLKASREEYNYFTLGDGQKSMNNAKTASIRVTCSNGKTITTESVPIDQPQKVTSASGNC |
Purity : | >90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.64 mg/mL |
Storage Buffer : | 20mM Tris pH8.0, 100mM NaCl |
Official Symbol | SPE196 |
Synonyms | SPE196 |
◆ Recombinant Proteins | ||
DCHS1-2230M | Recombinant Mouse DCHS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Ccl6-617M | Recombinant Mouse Ccl6 protein | +Inquiry |
SERPINB4-896H | Recombinant Human SERPINB4 protein, His-tagged | +Inquiry |
SETD7-4166R | Recombinant Rhesus monkey SETD7 Protein, His-tagged | +Inquiry |
JPH3-6577Z | Recombinant Zebrafish JPH3 | +Inquiry |
◆ Native Proteins | ||
CGB-1850H | Native Human Chorionic Gonadotropin, Beta Polypeptide | +Inquiry |
MMP9-29698TH | Native Human MMP9 | +Inquiry |
MMP9-39H | Native Human MMP-9/Lipocalin Complex | +Inquiry |
ATF-24B | Native Bovine Bovine Apo Transferrin | +Inquiry |
Prothrombin-58M | Native Mouse Prothrombin | +Inquiry |
◆ Cell & Tissue Lysates | ||
NEUROD1-3868HCL | Recombinant Human NEUROD1 293 Cell Lysate | +Inquiry |
EDA2R-1335MCL | Recombinant Mouse EDA2R cell lysate | +Inquiry |
CLEC4D-1006RCL | Recombinant Rat CLEC4D cell lysate | +Inquiry |
MYO1A-4010HCL | Recombinant Human MYO1A 293 Cell Lysate | +Inquiry |
SLC22A24-1100HCL | Recombinant Human SLC22A24 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPE196 Products
Required fields are marked with *
My Review for All SPE196 Products
Required fields are marked with *
0
Inquiry Basket