Recombinant Setaria italica LOC101782527-09S Protein, His-tagged
Cat.No. : | LOC101782527-09S |
Product Overview : | Recombinant Setaria italica LOC101782527-09S Protein, fused to His-tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Setaria italica |
Source : | E.coli |
Tag : | His |
Description : | UDP-glycosyltransferase 91A1 |
Form : | 50 mM Tris, 300 mM NaCl, pH 8.0. |
Molecular Mass : | 49.7kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMDASDSSPLHIVIFPWLAFGHMLASLELAERLAARGHRVSFVSTPRNISRLRPVPPALAPLIDFVALPLPRVDGLPDGAEATSDIPPGKTELHLKALDGLAAPFAAFLDAACADGSTNKVDWLFLDNFQYWAAAAAADHKIPCALNLTFAASTSAEYGVPRVEPPVDGSTASILQRFVLTLEKCQFVIQRACFELEPEPLPLLSDIFGKPVIPYGLVPPCPPAEGHKREHGNAALSWLDKQQPESVLFIALGSEPPVTVEQLHEIALGLELAGTTFLWALKKPNGLLLEADGDILPPGFEERTRDRGLVAMGWVPQPIILAHSSVGAFLTHGGWASTIEGVMSGHPMLFLTFLDEQRINAQLIERKKAGLRVPRREKDGSYDRQGIAGAIRAVMCEEESKSVFAANAKKMQEIVSDRNCQEKYIDELIQRLGSFEK |
Storage : | Short Term Storage at 4 centigrade, Long Term Storage at -20 centigrade to -80 centigrade. Avoid freeze/thaw cycles. |
Concentration : | 0.77 mg/ml |
Gene Name | LOC101782527 UDP-glycosyltransferase 91A1 [ Setaria italica (foxtail millet) ] |
Official Symbol | LOC101782527 |
Gene ID | 101782527 |
mRNA Refseq | XM_004982002 |
Protein Refseq | XP_004982059 |
UniProt ID | K4AME6 |
◆ Native Proteins | ||
APOC3-8040H | Native Human ApoLipoprotein CIII | +Inquiry |
FLNA-170C | Active Native chicken FLNA | +Inquiry |
Lectin-1831R | Active Native Ricinus Communis Agglutinin I Protein, Biotinylated | +Inquiry |
IgM-344D | Native Donkey IgM | +Inquiry |
Total RNA-01E | Native E. coli Total RNA | +Inquiry |
◆ Cell & Tissue Lysates | ||
HAUS7-5627HCL | Recombinant Human HAUS7 293 Cell Lysate | +Inquiry |
DCAF12L1-7058HCL | Recombinant Human DCAF12L1 293 Cell Lysate | +Inquiry |
MINOS1-8178HCL | Recombinant Human C1orf151 293 Cell Lysate | +Inquiry |
TRIM32-782HCL | Recombinant Human TRIM32 293 Cell Lysate | +Inquiry |
RABL2A-2570HCL | Recombinant Human RABL2A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All LOC101782527 Products
Required fields are marked with *
My Review for All LOC101782527 Products
Required fields are marked with *
0
Inquiry Basket