Recombinant Rotavirus A NSP4 Protein (52-175 aa), His-tagged
Cat.No. : | NSP4-1634R |
Product Overview : | Recombinant Rotavirus A (strain RVA/Human/United States/DS-1/1976/G2P1B[4]) (RV-A) (Rotavirus A (strain DS1)) NSP4 Protein (52-175 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rotavirus A |
Source : | Yeast |
Tag : | His |
Protein Length : | 52-175 aa |
Description : | Involved in virus morphogenesis. Functions as a receptor for the immature double-layered inner capsid particle (ICP) which transiently buds into the lumen of the rough endoplasmic reticulum during viral maturation .Enterotoxin that causes a phospholipase C-dependent elevation of the intracellular calcium concentration in host intestinal mucosa cells. Increased concentration of intracellular calcium disrupts the cytoskeleton and the tight junctions, raising the paracellular permeability. Potentiates chloride ion secretion through a calcium ion-dependent signaling pathway, inducing age-dependent diarrhea. To perform this enterotoxigenic role in vivo, NSP4 is probably released from infected enterocytes in a soluble form capable of diffusing within the intestinal lumen and interacting with the plasma mbrane receptors on neighboring epithelial cells. Possible receptors for NSP4 are alpha-1/beta-1 and alpha-2/beta-1 integrin heterodimers. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 16.7 kDa |
AA Sequence : | PTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVRSTDEIDMTKEINQKNVRTLEEWENGKNPYEPKEVTAAM |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Synonyms | NSP4; |
UniProt ID | B3SRT2 |
◆ Recombinant Proteins | ||
NSP4-977R | Recombinant Rotavirus A NSP4 Protein (52-175 aa), His-SUMO-tagged | +Inquiry |
NSP4-4298R | Recombinant Rotavirus A NSP4 protein, His-SUMO-tagged | +Inquiry |
NSP4-1029H | Recombinant SARS-CoV-2 NSP4 Protein (N405-Q500), Tag Free | +Inquiry |
NSP4-5726R | Recombinant Rotavirus A (strain St. Thomas 3) NSP4 protein, His-tagged | +Inquiry |
NSP4-1030H | Recombinant SARS-CoV-2 NSP4 Protein (N405-Q500), GST tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NSP4 Products
Required fields are marked with *
My Review for All NSP4 Products
Required fields are marked with *
0
Inquiry Basket